Recombinant Human YARS, His-tagged
Cat.No. : | YARS-31445TH |
Product Overview : | Recombinant full length Human Tyrosyl tRNA synthetase with an N terminal His tag ; predicted mwt: 61.3 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 528 amino acids |
Description : | Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine. |
Conjugation : | HIS |
Molecular Weight : | 61.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS |
Sequence Similarities : | Belongs to the class-I aminoacyl-tRNA synthetase family.Contains 1 tRNA-binding domain. |
Gene Name | YARS tyrosyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | YARS |
Synonyms | YARS; tyrosyl-tRNA synthetase; tyrosyl-tRNA synthetase, cytoplasmic; tyrosine tRNA ligase 1; cytoplasmic; tyrRS; YRS; YTS; |
Gene ID | 8565 |
mRNA Refseq | NM_003680 |
Protein Refseq | NP_003671 |
MIM | 603623 |
Uniprot ID | P54577 |
Chromosome Location | 1p35.1 |
Pathway | Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; |
Function | ATP binding; interleukin-8 receptor binding; ligase activity; nucleotide binding; signal transducer activity; |
◆ Recombinant Proteins | ||
YARS-207H | Recombinant Human YARS protein, T7/His-tagged | +Inquiry |
YARS-10248M | Recombinant Mouse YARS Protein, His (Fc)-Avi-tagged | +Inquiry |
YARS-1459C | Recombinant Chicken YARS | +Inquiry |
YARS-2511H | Recombinant Human YARS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YARS-991H | Recombinant Human YARS protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YARS-249HCL | Recombinant Human YARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YARS Products
Required fields are marked with *
My Review for All YARS Products
Required fields are marked with *
0
Inquiry Basket