Recombinant Human YES proto oncogene 1, Src family tyrosine kinase Protein, His tagged

Cat.No. : YES1-001H
Product Overview : Recombinant Human YES1 Protein with His tag was expressed in E. coli.
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-88 aa
Description : This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.
Tag : C-His
Molecular Mass : 10 kDa
AA Sequence : MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.8 mg/mL by BCA
Gene Name YES1 YES proto-oncogene 1, Src family tyrosine kinase [ Homo sapiens (human) ]
Official Symbol YES1
Synonyms YES1; v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1; tyrosine-protein kinase Yes; c yes; HsT441; Yes; proto-oncogene c-Yes; cellular yes-1 protein; Yamaguchi sarcoma oncogene; proto-oncogene tyrosine-protein kinase YES; c-yes; P61-YES
Gene ID 7525
mRNA Refseq NM_005433
Protein Refseq NP_005424
MIM 164880
UniProt ID P07947

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YES1 Products

Required fields are marked with *

My Review for All YES1 Products

Required fields are marked with *

0
cart-icon
0
compare icon