Recombinant Human YIPF1 protein, His-tagged
Cat.No. : | YIPF1-3069H |
Product Overview : | Recombinant Human YIPF1 protein(1-94 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-94 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQPGSPRGSGREEDDELLGNDDSDKTELLAGQKKSSPFWTFEYYQTFFDVDTYQVF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | YIPF1 Yip1 domain family, member 1 [ Homo sapiens ] |
Official Symbol | YIPF1 |
Synonyms | FinGER1; DJ167A19.1 |
Gene ID | 54432 |
mRNA Refseq | NM_018982.4 |
Protein Refseq | NP_061855.1 |
UniProt ID | Q9Y548 |
◆ Recombinant Proteins | ||
YIPF1-4987C | Recombinant Chicken YIPF1 | +Inquiry |
YIPF1-3069H | Recombinant Human YIPF1 protein, His-tagged | +Inquiry |
RFL8237DF | Recombinant Full Length Dictyostelium Discoideum Protein Yipf1 Homolog(Yipf1) Protein, His-Tagged | +Inquiry |
RFL17402MF | Recombinant Full Length Mouse Protein Yipf1(Yipf1) Protein, His-Tagged | +Inquiry |
YIPF1-6282R | Recombinant Rat YIPF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YIPF1 Products
Required fields are marked with *
My Review for All YIPF1 Products
Required fields are marked with *
0
Inquiry Basket