Recombinant Human YJEFN3 protein
Cat.No. : | YJEFN3-3777H |
Product Overview : | Recombinant Human YJEFN3 protein(A6XGL0)(1-299aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-299aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.6 kDa |
AA Sequence : | MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | YJEFN3 YjeF N-terminal domain containing 3 [ Homo sapiens ] |
Official Symbol | YJEFN3 |
Synonyms | YJEFN3; YjeF N-terminal domain containing 3; yjeF N-terminal domain-containing protein 3; FLJ44968; hYjeF_N3 19p13.11; yjeF_N3; hYjeF_N3; hYjeF_N3-19p13.11; apolipoprotein A1 binding protein; MGC138490; |
Gene ID | 374887 |
mRNA Refseq | NM_001190328 |
Protein Refseq | NP_001177257 |
UniProt ID | A6XGL0 |
◆ Recombinant Proteins | ||
YJEFN3-603H | Recombinant Human YJEFN3 Protein, His-tagged | +Inquiry |
YJEFN3-3777H | Recombinant Human YJEFN3 protein | +Inquiry |
YJEFN3-153H | Recombinant Human YJEFN3 Protein, MYC/DDK-tagged | +Inquiry |
YJEFN3-3965Z | Recombinant Zebrafish YJEFN3 | +Inquiry |
YJEFN3-5547H | Recombinant Human YJEFN3 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YJEFN3 Products
Required fields are marked with *
My Review for All YJEFN3 Products
Required fields are marked with *
0
Inquiry Basket