Recombinant Human YJEFN3 protein

• Cat.No.: YJEFN3-3777H
• Product Overview: Recombinant Human YJEFN3 protein(A6XGL0)(1-299aa) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 1-299aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.6 kDa
• AA Sequence: MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: YJEFN3 YjeF N-terminal domain containing 3 [ Homo sapiens ]
• Official Symbol: YJEFN3
• Synonyms: YJEFN3; YjeF N-terminal domain containing 3; yjeF N-terminal domain-containing protein 3; FLJ44968; hYjeF_N3 19p13.11; yjeF_N3; hYjeF_N3; hYjeF_N3-19p13.11; apolipoprotein A1 binding protein; MGC138490
• Gene ID: 374887
• mRNA Refseq: NM_001190328
• Protein Refseq: NP_001177257
• UniProt ID: A6XGL0