Recombinant Human YPEL3 protein, His-SUMO-tagged
Cat.No. : | YPEL3-3778H |
Product Overview : | Recombinant Human YPEL3 protein(P61236)(1-119aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-119aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | YPEL3 yippee-like 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | YPEL3 |
Gene ID | 83719 |
mRNA Refseq | NM_031477.4 |
Protein Refseq | NP_113665.3 |
MIM | 609724 |
UniProt ID | P61236 |
◆ Recombinant Proteins | ||
YPEL3-10263M | Recombinant Mouse YPEL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
YPEL3-3769H | Recombinant Human YPEL3, His-tagged | +Inquiry |
YPEL3-3778H | Recombinant Human YPEL3 protein, His-SUMO-tagged | +Inquiry |
YPEL3-18672M | Recombinant Mouse YPEL3 Protein | +Inquiry |
YPEL3-12057Z | Recombinant Zebrafish YPEL3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YPEL3 Products
Required fields are marked with *
My Review for All YPEL3 Products
Required fields are marked with *
0
Inquiry Basket