Recombinant Human YTHDF1 protein, His-tagged
| Cat.No. : | YTHDF1-2478H |
| Product Overview : | Recombinant Human YTHDF1 protein(210-559 aa), fused to His tag, was expressed in E. coli. |
| Availability | May 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 210-559 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | YTHDF1 YTH domain family, member 1 [ Homo sapiens ] |
| Official Symbol | YTHDF1 |
| Synonyms | YTHDF1; YTH domain family, member 1; C20orf21, YTH domain family 1; YTH domain family protein 1; FLJ20391; DACA-1; YTH domain family 1; dermatomyositis associated with cancer putative autoantigen 1; C20orf21; |
| Gene ID | 54915 |
| mRNA Refseq | NM_017798 |
| Protein Refseq | NP_060268 |
| UniProt ID | Q9BYJ9 |
| ◆ Recombinant Proteins | ||
| YTHDF1-5244R | Recombinant Rhesus monkey YTHDF1 Protein, His-tagged | +Inquiry |
| YTHDF1-7855H | Recombinant Human YTHDF1 protein, His-tagged | +Inquiry |
| Ythdf1-7038M | Recombinant Mouse Ythdf1 Protein, Myc/DDK-tagged | +Inquiry |
| YTHDF1-11987Z | Recombinant Zebrafish YTHDF1 | +Inquiry |
| YTHDF1-2376H | Recombinant Human YTHDF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YTHDF1-237HCL | Recombinant Human YTHDF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YTHDF1 Products
Required fields are marked with *
My Review for All YTHDF1 Products
Required fields are marked with *
