Recombinant Human YTHDF1 protein, His-tagged

Cat.No. : YTHDF1-2478H
Product Overview : Recombinant Human YTHDF1 protein(210-559 aa), fused to His tag, was expressed in E. coli.
Availability September 19, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 210-559 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name YTHDF1 YTH domain family, member 1 [ Homo sapiens ]
Official Symbol YTHDF1
Synonyms YTHDF1; YTH domain family, member 1; C20orf21, YTH domain family 1; YTH domain family protein 1; FLJ20391; DACA-1; YTH domain family 1; dermatomyositis associated with cancer putative autoantigen 1; C20orf21;
Gene ID 54915
mRNA Refseq NM_017798
Protein Refseq NP_060268
UniProt ID Q9BYJ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YTHDF1 Products

Required fields are marked with *

My Review for All YTHDF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon