Recombinant Human YTHDF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | YTHDF1-979H |
Product Overview : | YTHDF1 MS Standard C13 and N15-labeled recombinant protein (NP_060268) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | YTHDF1 (YTH N6-Methyladenosine RNA Binding Protein 1) is a Protein Coding gene. Diseases associated with YTHDF1 include Wilms Tumor 1. Gene Ontology (GO) annotations related to this gene include N6-methyladenosine-containing RNA binding. An important paralog of this gene is YTHDF3. |
Molecular Mass : | 60.9 kDa |
AA Sequence : | MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | YTHDF1 YTH N6-methyladenosine RNA binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | YTHDF1 |
Synonyms | YTHDF1; YTH domain family, member 1; C20orf21, YTH domain family 1; YTH domain family protein 1; FLJ20391; DACA-1; YTH domain family 1; dermatomyositis associated with cancer putative autoantigen 1; C20orf21; |
Gene ID | 54915 |
mRNA Refseq | NM_017798 |
Protein Refseq | NP_060268 |
MIM | 616529 |
UniProt ID | Q9BYJ9 |
◆ Recombinant Proteins | ||
YTHDF1-2057C | Recombinant Chicken YTHDF1 | +Inquiry |
YTHDF1-3773H | Recombinant Human YTHDF1 protein, GST-tagged | +Inquiry |
YTHDF1-5244R | Recombinant Rhesus monkey YTHDF1 Protein, His-tagged | +Inquiry |
YTHDF1-2376H | Recombinant Human YTHDF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YTHDF1-11987Z | Recombinant Zebrafish YTHDF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
YTHDF1-237HCL | Recombinant Human YTHDF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YTHDF1 Products
Required fields are marked with *
My Review for All YTHDF1 Products
Required fields are marked with *
0
Inquiry Basket