Recombinant Human YTHDF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : YTHDF1-979H
Product Overview : YTHDF1 MS Standard C13 and N15-labeled recombinant protein (NP_060268) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : YTHDF1 (YTH N6-Methyladenosine RNA Binding Protein 1) is a Protein Coding gene. Diseases associated with YTHDF1 include Wilms Tumor 1. Gene Ontology (GO) annotations related to this gene include N6-methyladenosine-containing RNA binding. An important paralog of this gene is YTHDF3.
Molecular Mass : 60.9 kDa
AA Sequence : MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name YTHDF1 YTH N6-methyladenosine RNA binding protein 1 [ Homo sapiens (human) ]
Official Symbol YTHDF1
Synonyms YTHDF1; YTH domain family, member 1; C20orf21, YTH domain family 1; YTH domain family protein 1; FLJ20391; DACA-1; YTH domain family 1; dermatomyositis associated with cancer putative autoantigen 1; C20orf21;
Gene ID 54915
mRNA Refseq NM_017798
Protein Refseq NP_060268
MIM 616529
UniProt ID Q9BYJ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YTHDF1 Products

Required fields are marked with *

My Review for All YTHDF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon