Recombinant Human YTHDF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: YTHDF1-979H
• Product Overview: YTHDF1 MS Standard C13 and N15-labeled recombinant protein (NP_060268) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: YTHDF1 (YTH N6-Methyladenosine RNA Binding Protein 1) is a Protein Coding gene. Diseases associated with YTHDF1 include Wilms Tumor 1. Gene Ontology (GO) annotations related to this gene include N6-methyladenosine-containing RNA binding. An important paralog of this gene is YTHDF3.
• Molecular Mass: 60.9 kDa
• AA Sequence: MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: YTHDF1 YTH N6-methyladenosine RNA binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: YTHDF1
• Synonyms: YTHDF1; YTH domain family, member 1; C20orf21, YTH domain family 1; YTH domain family protein 1; FLJ20391; DACA-1; YTH domain family 1; dermatomyositis associated with cancer putative autoantigen 1; C20orf21
• Gene ID: 54915
• mRNA Refseq: NM_017798
• Protein Refseq: NP_060268
• MIM: 616529
• UniProt ID: Q9BYJ9