Recombinant Human YTHDF2 protein(2-579aa), His-tagged
Cat.No. : | YTHDF2-5322H |
Product Overview : | Recombinant Human YTHDF2 protein(Q9Y5A9)(2-579aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 2-579aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 68.2 kDa |
AASequence : | SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | YTHDF2 YTH domain family, member 2 [ Homo sapiens ] |
Official Symbol | YTHDF2 |
Synonyms | YTHDF2; YTH domain family, member 2; YTH domain family 2; YTH domain family protein 2; HGRG8; NY REN 2; 9430020E02Rik; CLL-associated antigen KW-14; high-glucose-regulated protein 8; renal carcinoma antigen NY-REN-2; NY-REN-2; |
Gene ID | 51441 |
mRNA Refseq | NM_001172828 |
Protein Refseq | NP_001166299 |
MIM | 610640 |
UniProt ID | Q9Y5A9 |
◆ Native Proteins | ||
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
Small Intestine-014H | Human Small Intestine Lysate, Total Protein | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
HP-145M | Native Mouse Hemoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC28A1-1746HCL | Recombinant Human SLC28A1 293 Cell Lysate | +Inquiry |
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
SSX2IP-1700HCL | Recombinant Human SSX2IP cell lysate | +Inquiry |
IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
KDM8-5102HCL | Recombinant Human JMJD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YTHDF2 Products
Required fields are marked with *
My Review for All YTHDF2 Products
Required fields are marked with *
0
Inquiry Basket