Recombinant Human YWHAG, His-tagged
Cat.No. : | YWHAG-26009TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 1-247 of Human 14-3-3 gamma, with an N-terminal His tag; predicted MWt 31.8 kDa inclusive of tag.Residue M35 of the fusion protein is equivalent to M1 of the native protein. The His(6) tag is lo |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 247 amino acids |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. |
Conjugation : | HIS |
Molecular Weight : | 31.800kDa inclusive of tags |
Tissue specificity : | Highly expressed in brain, skeletal muscle, and heart. |
Form : | Liquid |
Purity : | Purified via His tag |
Storage buffer : | pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVDREQ LVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLS VAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYR EKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKM KGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ PTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGN N |
Sequence Similarities : | Belongs to the 14-3-3 family. |
Gene Name | YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide [ Homo sapiens ] |
Official Symbol | YWHAG |
Synonyms | YWHAG; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; 14-3-3 protein gamma; 14 3 3 gamma; |
Gene ID | 7532 |
mRNA Refseq | NM_012479 |
Protein Refseq | NP_036611 |
MIM | 605356 |
Uniprot ID | P61981 |
Chromosome Location | 7q11.23 |
Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; |
Function | insulin-like growth factor receptor binding; protein binding; protein domain specific binding; protein kinase C binding; protein kinase C inhibitor activity; |
◆ Recombinant Proteins | ||
Ywhag-151M | Recombinant Mouse Ywhag Protein, His-tagged | +Inquiry |
YWHAG-1387HFL | Recombinant Full Length Human YWHAG Protein, C-Flag-tagged | +Inquiry |
YWHAG-6934H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Gamma Polypeptide | +Inquiry |
YWHAG-144H | Recombinant Human YWHAG Protein, His-tagged | +Inquiry |
YWHAG-2379H | Recombinant Human YWHAG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAG-232HCL | Recombinant Human YWHAG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YWHAG Products
Required fields are marked with *
My Review for All YWHAG Products
Required fields are marked with *
0
Inquiry Basket