Recombinant Human YWHAG protein, GST-tagged
| Cat.No. : | YWHAG-149H |
| Product Overview : | Recombinant Human YWHAG protein(1-247 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-247 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN |
| Gene Name | YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide [ Homo sapiens ] |
| Official Symbol | YWHAG |
| Synonyms | YWHAG; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; 14-3-3 protein gamma; 14 3 3 gamma; KCIP-1; 14-3-3 gamma; protein kinase C inhibitor protein 1; 14-3-3GAMMA; |
| Gene ID | 7532 |
| mRNA Refseq | NM_012479 |
| Protein Refseq | NP_036611 |
| MIM | 605356 |
| UniProt ID | P61981 |
| ◆ Recombinant Proteins | ||
| ACSBG2-3422H | Recombinant Human ACSBG2 protein, His-tagged | +Inquiry |
| ACSBG2-2069C | Recombinant Chicken ACSBG2 | +Inquiry |
| ACSBG2-9316H | Recombinant Human ACSBG2, His-tagged | +Inquiry |
| ACSBG2-827HF | Recombinant Full Length Human ACSBG2 Protein, GST-tagged | +Inquiry |
| ACSBG2-123R | Recombinant Rat ACSBG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACSBG2-18HCL | Recombinant Human ACSBG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSBG2 Products
Required fields are marked with *
My Review for All ACSBG2 Products
Required fields are marked with *
