Recombinant Human YWHAH, His-tagged

Cat.No. : YWHAH-26005TH
Product Overview : Recombinant full length protein corresponding to amino acids 1 - 246 of Human 14-3-3 eta; with an N-terminal his tag; predicted MWt 31.7 kDa inclusive of tag.Residue M35 of the fusion protein is equivalent to M1 of the native protein. The His(6) tag is lo
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 246 amino acids
Description : This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5 UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder.
Conjugation : HIS
Molecular Weight : 31.700kDa inclusive of tags
Tissue specificity : Expressed mainly in the brain and present in other tissues albeit at lower levels.
Form : Liquid
Purity : Purified via His tag
Storage buffer : pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGDREQ LLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLS VAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYR EKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKM KGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQ PTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Sequence Similarities : Belongs to the 14-3-3 family.
Gene Name YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide [ Homo sapiens ]
Official Symbol YWHAH
Synonyms YWHAH; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; 14-3-3 protein eta; 14 3 3 eta;
Gene ID 7533
mRNA Refseq NM_003405
Protein Refseq NP_003396
MIM 113508
Uniprot ID Q04917
Chromosome Location 22q12.1-q13.1
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem;
Function actin binding; enzyme binding; glucocorticoid receptor binding; insulin-like growth factor receptor binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YWHAH Products

Required fields are marked with *

My Review for All YWHAH Products

Required fields are marked with *

0
cart-icon