Recombinant Human YWHAH, His-tagged
Cat.No. : | YWHAH-26005TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 1 - 246 of Human 14-3-3 eta; with an N-terminal his tag; predicted MWt 31.7 kDa inclusive of tag.Residue M35 of the fusion protein is equivalent to M1 of the native protein. The His(6) tag is lo |
- Specification
- Gene Information
- Related Products
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5 UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. |
Protein length : | 246 amino acids |
Conjugation : | HIS |
Molecular Weight : | 31.700kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Expressed mainly in the brain and present in other tissues albeit at lower levels. |
Form : | Liquid |
Purity : | Purified via His tag |
Storage buffer : | pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGDREQ LLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLS VAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYR EKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKM KGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQ PTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN |
Sequence Similarities : | Belongs to the 14-3-3 family. |
Gene Name : | YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide [ Homo sapiens ] |
Official Symbol : | YWHAH |
Synonyms : | YWHAH; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; 14-3-3 protein eta; 14 3 3 eta; |
Gene ID : | 7533 |
mRNA Refseq : | NM_003405 |
Protein Refseq : | NP_003396 |
MIM : | 113508 |
Uniprot ID : | Q04917 |
Chromosome Location : | 22q12.1-q13.1 |
Pathway : | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; |
Function : | actin binding; enzyme binding; glucocorticoid receptor binding; insulin-like growth factor receptor binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
YWHAH-2562H | Recombinant Human YWHAH protein(Gly2-Asn246), GST-tagged | +Inquiry |
YWHAH-10270M | Recombinant Mouse YWHAH Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAH-6296R | Recombinant Rat YWHAH Protein, His (Fc)-Avi-tagged | +Inquiry |
Ywhah-7042M | Recombinant Mouse Ywhah Protein, Myc/DDK-tagged | +Inquiry |
YWHAH-5061R | Recombinant Rhesus Macaque YWHAH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
YWHAH-231HCL | Recombinant Human YWHAH 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket