Recombinant Human YWHAH, His-tagged
Cat.No. : | YWHAH-26005TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 1 - 246 of Human 14-3-3 eta; with an N-terminal his tag; predicted MWt 31.7 kDa inclusive of tag.Residue M35 of the fusion protein is equivalent to M1 of the native protein. The His(6) tag is lo |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 246 amino acids |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5 UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. |
Conjugation : | HIS |
Molecular Weight : | 31.700kDa inclusive of tags |
Tissue specificity : | Expressed mainly in the brain and present in other tissues albeit at lower levels. |
Form : | Liquid |
Purity : | Purified via His tag |
Storage buffer : | pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGDREQ LLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLS VAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYR EKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKM KGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQ PTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN |
Sequence Similarities : | Belongs to the 14-3-3 family. |
Gene Name | YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide [ Homo sapiens ] |
Official Symbol | YWHAH |
Synonyms | YWHAH; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; 14-3-3 protein eta; 14 3 3 eta; |
Gene ID | 7533 |
mRNA Refseq | NM_003405 |
Protein Refseq | NP_003396 |
MIM | 113508 |
Uniprot ID | Q04917 |
Chromosome Location | 22q12.1-q13.1 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; |
Function | actin binding; enzyme binding; glucocorticoid receptor binding; insulin-like growth factor receptor binding; protein binding; |
◆ Recombinant Proteins | ||
YWHAH-143H | Recombinant Human YWHAH Protein, GST-tagged | +Inquiry |
Ywhah-5069R | Recombinant Rat Ywhah protein | +Inquiry |
YWHAH-18685M | Recombinant Mouse YWHAH Protein | +Inquiry |
Ywhah-5066R | Recombinant Rat Ywhah protein | +Inquiry |
YWHAH-5061R | Recombinant Rhesus Macaque YWHAH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAH-231HCL | Recombinant Human YWHAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAH Products
Required fields are marked with *
My Review for All YWHAH Products
Required fields are marked with *