Recombinant Human YWHAH Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: YWHAH-871H
• Product Overview: YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder.
• Molecular Mass: 28.2 kDa
• AA Sequence: MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta [ Homo sapiens (human) ]
• Official Symbol: YWHAH
• Synonyms: YWHAH; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; 14-3-3 protein eta; 14 3 3 eta; 14-3-3 eta
• Gene ID: 7533
• mRNA Refseq: NM_003405
• Protein Refseq: NP_003396
• MIM: 113508
• UniProt ID: Q04917