Recombinant Human YWHAH Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | YWHAH-871H |
| Product Overview : | YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. |
| Molecular Mass : | 28.2 kDa |
| AA Sequence : | MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta [ Homo sapiens (human) ] |
| Official Symbol | YWHAH |
| Synonyms | YWHAH; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; 14-3-3 protein eta; 14 3 3 eta; 14-3-3 eta; |
| Gene ID | 7533 |
| mRNA Refseq | NM_003405 |
| Protein Refseq | NP_003396 |
| MIM | 113508 |
| UniProt ID | Q04917 |
| ◆ Recombinant Proteins | ||
| Ywhah-140M | Recombinant Mouse Ywhah Protein, His-tagged | +Inquiry |
| YWHAH-4250H | Recombinant Human YWHAH protein, His-tagged | +Inquiry |
| YWHAH-3775H | Recombinant Human YWHAH, His-tagged | +Inquiry |
| YWHAH-18685M | Recombinant Mouse YWHAH Protein | +Inquiry |
| Ywhah-4804M | Recombinant Mouse Ywhah protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YWHAH-231HCL | Recombinant Human YWHAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAH Products
Required fields are marked with *
My Review for All YWHAH Products
Required fields are marked with *
