Recombinant Human YWHAH Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | YWHAH-871H |
Product Overview : | YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. |
Molecular Mass : | 28.2 kDa |
AA Sequence : | MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta [ Homo sapiens (human) ] |
Official Symbol | YWHAH |
Synonyms | YWHAH; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; 14-3-3 protein eta; 14 3 3 eta; 14-3-3 eta; |
Gene ID | 7533 |
mRNA Refseq | NM_003405 |
Protein Refseq | NP_003396 |
MIM | 113508 |
UniProt ID | Q04917 |
◆ Recombinant Proteins | ||
YWHAH-871H | Recombinant Human YWHAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YWHAH-142H | Recombinant Human YWHAH Protein, GST-tagged | +Inquiry |
Ywhah-5067R | Recombinant Rat Ywhah protein | +Inquiry |
YWHAH-5061R | Recombinant Rhesus Macaque YWHAH Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAH-5176H | Recombinant Human YWHAH protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAH-231HCL | Recombinant Human YWHAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAH Products
Required fields are marked with *
My Review for All YWHAH Products
Required fields are marked with *