Recombinant Human YWHAZ protein, His-GST-tagged
Cat.No. : | YWHAZ-3779H |
Product Overview : | Recombinant Human YWHAZ protein(P63104)(133-212aa), fused to N-terminal His-GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 133-212aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.6 kDa |
AA Sequence : | AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Homo sapiens ] |
Official Symbol | YWHAZ |
Synonyms | YWHAZ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide , YWHAD; 14-3-3 protein zeta/delta; 14 3 3 delta; 14 3 3 zeta; KCIP 1; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; YWHAD; KCIP-1; 14-3-3-zeta; MGC111427; MGC126532; MGC138156; |
Gene ID | 7534 |
mRNA Refseq | NM_001135699 |
Protein Refseq | NP_001129171 |
MIM | 601288 |
UniProt ID | P63104 |
◆ Recombinant Proteins | ||
Ywhaz-7044M | Recombinant Mouse Ywhaz Protein, Myc/DDK-tagged | +Inquiry |
YWHAZ-467HFL | Recombinant Full Length Human YWHAZ Protein, C-Flag-tagged | +Inquiry |
YWHAZ-12027Z | Recombinant Zebrafish YWHAZ | +Inquiry |
YWHAZ-5249R | Recombinant Rhesus monkey YWHAZ Protein, His-tagged | +Inquiry |
YWHAZ-4901H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Zeta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAZ-229HCL | Recombinant Human YWHAZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAZ Products
Required fields are marked with *
My Review for All YWHAZ Products
Required fields are marked with *