Recombinant Human ZBTB16 Protein, His tagged
| Cat.No. : | ZBTB16-001H |
| Product Overview : | Recombinant human zinc finger and BTB domain containing 16 Protein (1-254aa) with N His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-254aa |
| Description : | This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. |
| Tag : | N-His |
| Molecular Mass : | 28.6 kDa |
| AA Sequence : | MHHHHHHDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQ |
| Endotoxin : | < 0.1 EU/μg by LAL |
| Purity : | > 95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| Concentration : | 1.0 mg/mL |
| Gene Name | ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens (human) ] |
| Official Symbol | ZBTB16 |
| Synonyms | ZBTB16; zinc finger and BTB domain containing 16; zinc finger protein 145 (Kruppel like, expressed in promyelocytic leukemia) , ZNF145; zinc finger and BTB domain-containing protein 16; PLZF; zinc finger protein PLZF; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); ZNF145; |
| Gene ID | 7704 |
| mRNA Refseq | NM_001018011 |
| Protein Refseq | NP_001018011 |
| MIM | 176797 |
| UniProt ID | Q05516 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB16 Products
Required fields are marked with *
My Review for All ZBTB16 Products
Required fields are marked with *
