Recombinant Human ZBTB16 Protein, His tagged

Cat.No. : ZBTB16-001H
Product Overview : Recombinant human zinc finger and BTB domain containing 16 Protein (1-254aa) with N His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-254aa
Description : This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.
Tag : N-His
Molecular Mass : 28.6 kDa
AA Sequence : MHHHHHHDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQ
Endotoxin : < 0.1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH 7.4
Concentration : 1.0 mg/mL
Gene Name ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens (human) ]
Official Symbol ZBTB16
Synonyms ZBTB16; zinc finger and BTB domain containing 16; zinc finger protein 145 (Kruppel like, expressed in promyelocytic leukemia) , ZNF145; zinc finger and BTB domain-containing protein 16; PLZF; zinc finger protein PLZF; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); ZNF145;
Gene ID 7704
mRNA Refseq NM_001018011
Protein Refseq NP_001018011
MIM 176797
UniProt ID Q05516

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZBTB16 Products

Required fields are marked with *

My Review for All ZBTB16 Products

Required fields are marked with *

0
cart-icon
0
compare icon