Recombinant Human ZBTB39 protein, His-tagged
Cat.No. : | ZBTB39-6754H |
Product Overview : | Recombinant Human ZBTB39 protein(207-388 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 207-388 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | PKTEDHDTPAPFTSIPSMMTQPLLGTVSTGIQTSTSSCQPYKVQSNGDFSKNSFLTPDNAVDITTGTNSCLSNSEHSKDPGFGQMDELQLEDLGDDDLQFEDPAEDIGTTEEVIELSDDSEDELAFGENDNRENKAMPCQVCKKVLEPNIQLIRQHARDHVDLLTGNCKVCETHFQDRNSRV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ZBTB39 zinc finger and BTB domain containing 39 [ Homo sapiens ] |
Official Symbol | ZBTB39 |
Synonyms | ZBTB39; zinc finger and BTB domain containing 39; zinc finger and BTB domain-containing protein 39; KIAA0352; ZNF922; |
Gene ID | 9880 |
mRNA Refseq | NM_014830 |
Protein Refseq | NP_055645 |
UniProt ID | O15060 |
◆ Recombinant Proteins | ||
ZBTB39-5073R | Recombinant Rhesus Macaque ZBTB39 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB39-5260R | Recombinant Rhesus monkey ZBTB39 Protein, His-tagged | +Inquiry |
ZBTB39-6754H | Recombinant Human ZBTB39 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB39-1955HCL | Recombinant Human ZBTB39 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB39 Products
Required fields are marked with *
My Review for All ZBTB39 Products
Required fields are marked with *
0
Inquiry Basket