Recombinant Human ZBTB7B Protein, GST-tagged

Cat.No. : ZBTB7B-21H
Product Overview : Human ZBTB7B partial ORF ( NP_056956.1, 433 a.a. - 537 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a zinc finger-containing transcription factor that acts as a key regulator of lineage commitment of immature T-cell precursors. It is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. It also functions as a transcriptional repressor of type I collagen genes. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 37.29 kDa
AA Sequence : HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZBTB7B zinc finger and BTB domain containing 7B [ Homo sapiens (human) ]
Official Symbol ZBTB7B
Synonyms ZBTB7B; zinc finger and BTB domain containing 7B; CKROX; THPOK; ZFP67; ZBTB15; ZFP-67; c-KROX; hcKROX; ZNF857B; zinc finger and BTB domain-containing protein 7B; T-helper-inducing POZ/Krueppel-like factor; krueppel-related zinc finger protein cKrox; zinc finger and BTB domain containing 15; zinc finger protein 67 homolog; zinc finger protein 857B; zinc finger protein Th-POK
Gene ID 51043
mRNA Refseq NM_015872
Protein Refseq NP_056956
MIM 607646
UniProt ID O15156

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZBTB7B Products

Required fields are marked with *

My Review for All ZBTB7B Products

Required fields are marked with *

0
cart-icon
0
compare icon