Recombinant Human ZBTB7B Protein, GST-tagged
Cat.No. : | ZBTB7B-21H |
Product Overview : | Human ZBTB7B partial ORF ( NP_056956.1, 433 a.a. - 537 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a zinc finger-containing transcription factor that acts as a key regulator of lineage commitment of immature T-cell precursors. It is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. It also functions as a transcriptional repressor of type I collagen genes. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 37.29 kDa |
AA Sequence : | HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ZBTB7B zinc finger and BTB domain containing 7B [ Homo sapiens (human) ] |
Official Symbol | ZBTB7B |
Synonyms | ZBTB7B; zinc finger and BTB domain containing 7B; CKROX; THPOK; ZFP67; ZBTB15; ZFP-67; c-KROX; hcKROX; ZNF857B; zinc finger and BTB domain-containing protein 7B; T-helper-inducing POZ/Krueppel-like factor; krueppel-related zinc finger protein cKrox; zinc finger and BTB domain containing 15; zinc finger protein 67 homolog; zinc finger protein 857B; zinc finger protein Th-POK |
Gene ID | 51043 |
mRNA Refseq | NM_015872 |
Protein Refseq | NP_056956 |
MIM | 607646 |
UniProt ID | O15156 |
◆ Recombinant Proteins | ||
ZBTB7B-3786H | Recombinant Human ZBTB7B, GST-tagged | +Inquiry |
ZBTB7B-21H | Recombinant Human ZBTB7B Protein, GST-tagged | +Inquiry |
ZBTB7B-29517TH | Recombinant Human ZBTB7B, His-tagged | +Inquiry |
ZBTB7B-1275H | Recombinant Human ZBTB7B Protein (G2-S539), Tag Free | +Inquiry |
ZBTB7B-1276H | Recombinant Human ZBTB7B Protein (G2-S539), His/StrepII tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB7B-211HCL | Recombinant Human ZBTB7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB7B Products
Required fields are marked with *
My Review for All ZBTB7B Products
Required fields are marked with *