Recombinant Human ZC2HC1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZC2HC1B-3804H
Product Overview : C6orf94 MS Standard C13 and N15-labeled recombinant protein (NP_001013645) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ZC2HC1B (Zinc Finger C2HC-Type Containing 1B) is a Protein Coding gene. Diseases associated with ZC2HC1B include Transient Neonatal Diabetes Mellitus. An important paralog of this gene is ZC2HC1A.
Molecular Mass : 24.5 kDa
AA Sequence : MAGAEPFLADGNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFCKDQSSRRVFNPAQTAAKLASRAQGRAQMGPKKEPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAKLRQGFSKSSKKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZC2HC1B zinc finger C2HC-type containing 1B [ Homo sapiens (human) ]
Official Symbol ZC2HC1B
Synonyms ZC2HC1B; zinc finger C2HC-type containing 1B; C6orf94; FAM164B; dJ468K18.5; zinc finger C2HC domain-containing protein 1B; family with sequence similarity 164, member B; protein FAM164B
Gene ID 153918
mRNA Refseq NM_001013623
Protein Refseq NP_001013645
UniProt ID Q5TFG8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZC2HC1B Products

Required fields are marked with *

My Review for All ZC2HC1B Products

Required fields are marked with *

0
cart-icon