Recombinant Human ZC3H12D protein, His-tagged
Cat.No. : | ZC3H12D-3793H |
Product Overview : | Recombinant Human ZC3H12D protein(1-90 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-90 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZC3H12D zinc finger CCCH-type containing 12D [ Homo sapiens ] |
Official Symbol | ZC3H12D |
Synonyms | ZC3H12D; zinc finger CCCH-type containing 12D; C6orf95, chromosome 6 open reading frame 95; probable ribonuclease ZC3H12D; dJ281H8.1; MCP induced protein 4; MCPIP4; tumor suppressor TFL; MCP-induced protein 4; transformed follicular lymphoma; Zinc finger CCCH domain-containing protein 12D; TFL; p34; C6orf95; FLJ00361; FLJ46041; |
Gene ID | 340152 |
mRNA Refseq | NM_207360 |
Protein Refseq | NP_997243 |
MIM | 611106 |
UniProt ID | A2A288 |
◆ Recombinant Proteins | ||
ZC3H12D-3793H | Recombinant Human ZC3H12D protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZC3H12D Products
Required fields are marked with *
My Review for All ZC3H12D Products
Required fields are marked with *