Recombinant Human ZCCHC24 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZCCHC24-4153H |
Product Overview : | ZCCHC24 MS Standard C13 and N15-labeled recombinant protein (NP_699198) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ZCCHC24 (Zinc Finger CCHC-Type Containing 24) is a Protein Coding gene. Diseases associated with ZCCHC24 include Marshall-Smith Syndrome. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is RBBP6. |
Molecular Mass : | 26.9 kDa |
AA Sequence : | MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPVPTAGAAPPELAFGKGRPEQLGSPLHSSYLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZCCHC24 zinc finger CCHC-type containing 24 [ Homo sapiens (human) ] |
Official Symbol | ZCCHC24 |
Synonyms | ZCCHC24; zinc finger CCHC-type containing 24; Z3CXXC8; C10orf56; zinc finger CCHC domain-containing protein 24; zinc finger, 3CxxC-type 8; zinc finger, CCHC domain containing 24 |
Gene ID | 219654 |
mRNA Refseq | NM_153367 |
Protein Refseq | NP_699198 |
UniProt ID | Q8N2G6 |
◆ Recombinant Proteins | ||
ZCCHC24-1824H | Recombinant Human ZCCHC24 | +Inquiry |
ZCCHC24-4319H | Recombinant Human ZCCHC24 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZCCHC24-4153H | Recombinant Human ZCCHC24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Zcchc24-7066M | Recombinant Mouse Zcchc24 Protein, Myc/DDK-tagged | +Inquiry |
ZCCHC24-5678Z | Recombinant Zebrafish ZCCHC24 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZCCHC24-201HCL | Recombinant Human ZCCHC24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZCCHC24 Products
Required fields are marked with *
My Review for All ZCCHC24 Products
Required fields are marked with *