Recombinant Human ZCCHC9 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZCCHC9-5710H
Product Overview : ZCCHC9 MS Standard C13 and N15-labeled recombinant protein (NP_115656) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ZCCHC9 (Zinc Finger CCHC-Type Containing 9) is a Protein Coding gene. Diseases associated with ZCCHC9 include Alveoli Adenoma and Bronchial Benign Neoplasm. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZCCHC7.
Molecular Mass : 30.5 kDa
AA Sequence : MTRWARVSTTYNKRALPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZCCHC9 zinc finger CCHC-type containing 9 [ Homo sapiens (human) ]
Official Symbol ZCCHC9
Synonyms ZCCHC9; zinc finger CCHC-type containing 9; PPP1R41; zinc finger CCHC domain-containing protein 9; protein phosphatase 1, regulatory subunit 41; zinc finger, CCHC domain containing 9
Gene ID 84240
mRNA Refseq NM_032280
Protein Refseq NP_115656
UniProt ID Q8N567

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZCCHC9 Products

Required fields are marked with *

My Review for All ZCCHC9 Products

Required fields are marked with *

0
cart-icon