Recombinant Human ZCCHC9 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZCCHC9-5710H |
Product Overview : | ZCCHC9 MS Standard C13 and N15-labeled recombinant protein (NP_115656) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ZCCHC9 (Zinc Finger CCHC-Type Containing 9) is a Protein Coding gene. Diseases associated with ZCCHC9 include Alveoli Adenoma and Bronchial Benign Neoplasm. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZCCHC7. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | MTRWARVSTTYNKRALPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZCCHC9 zinc finger CCHC-type containing 9 [ Homo sapiens (human) ] |
Official Symbol | ZCCHC9 |
Synonyms | ZCCHC9; zinc finger CCHC-type containing 9; PPP1R41; zinc finger CCHC domain-containing protein 9; protein phosphatase 1, regulatory subunit 41; zinc finger, CCHC domain containing 9 |
Gene ID | 84240 |
mRNA Refseq | NM_032280 |
Protein Refseq | NP_115656 |
UniProt ID | Q8N567 |
◆ Recombinant Proteins | ||
ZCCHC9-5710H | Recombinant Human ZCCHC9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZCCHC9-9829Z | Recombinant Zebrafish ZCCHC9 | +Inquiry |
ZCCHC9-317H | Recombinant Human ZCCHC9 Protein, His-tagged | +Inquiry |
ZCCHC9-5087R | Recombinant Rhesus Macaque ZCCHC9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Zcchc9-7068M | Recombinant Mouse Zcchc9 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZCCHC9-198HCL | Recombinant Human ZCCHC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZCCHC9 Products
Required fields are marked with *
My Review for All ZCCHC9 Products
Required fields are marked with *