Recombinant Human ZDHHC15 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZDHHC15-676H
Product Overview : ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 39.2 kDa
AA Sequence : MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETETTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZDHHC15 zinc finger DHHC-type palmitoyltransferase 15 [ Homo sapiens (human) ]
Official Symbol ZDHHC15
Synonyms ZDHHC15; zinc finger DHHC-type palmitoyltransferase 15; MRX91; DHHC15; palmitoyltransferase ZDHHC15; DHHC-15; acyltransferase ZDHHC15; zinc finger DHHC domain-containing protein 15; zinc finger DHHC-type containing 15; zinc finger, DHHC domain containing 15; EC 2.3.1.225
Gene ID 158866
mRNA Refseq NM_144969
Protein Refseq NP_659406
MIM 300576
UniProt ID Q96MV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZDHHC15 Products

Required fields are marked with *

My Review for All ZDHHC15 Products

Required fields are marked with *

0
cart-icon
0
compare icon