Recombinant Human ZDHHC15 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ZDHHC15-676H |
| Product Overview : | ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 39.2 kDa |
| AA Sequence : | MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETETTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ZDHHC15 zinc finger DHHC-type palmitoyltransferase 15 [ Homo sapiens (human) ] |
| Official Symbol | ZDHHC15 |
| Synonyms | ZDHHC15; zinc finger DHHC-type palmitoyltransferase 15; MRX91; DHHC15; palmitoyltransferase ZDHHC15; DHHC-15; acyltransferase ZDHHC15; zinc finger DHHC domain-containing protein 15; zinc finger DHHC-type containing 15; zinc finger, DHHC domain containing 15; EC 2.3.1.225 |
| Gene ID | 158866 |
| mRNA Refseq | NM_144969 |
| Protein Refseq | NP_659406 |
| MIM | 300576 |
| UniProt ID | Q96MV8 |
| ◆ Recombinant Proteins | ||
| RFL25219HF | Recombinant Full Length Human Palmitoyltransferase Zdhhc15(Zdhhc15) Protein, His-Tagged | +Inquiry |
| ZDHHC15-6316R | Recombinant Rat ZDHHC15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL19461XF | Recombinant Full Length Xenopus Laevis Palmitoyltransferase Zdhhc15(Zdhhc15) Protein, His-Tagged | +Inquiry |
| ZDHHC15-3791H | Recombinant Human ZDHHC15, GST-tagged | +Inquiry |
| ZDHHC15-4643H | Recombinant Human ZDHHC15 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZDHHC15-195HCL | Recombinant Human ZDHHC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC15 Products
Required fields are marked with *
My Review for All ZDHHC15 Products
Required fields are marked with *



