Recombinant Human ZDHHC15 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZDHHC15-676H |
Product Overview : | ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETETTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZDHHC15 zinc finger DHHC-type palmitoyltransferase 15 [ Homo sapiens (human) ] |
Official Symbol | ZDHHC15 |
Synonyms | ZDHHC15; zinc finger DHHC-type palmitoyltransferase 15; MRX91; DHHC15; palmitoyltransferase ZDHHC15; DHHC-15; acyltransferase ZDHHC15; zinc finger DHHC domain-containing protein 15; zinc finger DHHC-type containing 15; zinc finger, DHHC domain containing 15; EC 2.3.1.225 |
Gene ID | 158866 |
mRNA Refseq | NM_144969 |
Protein Refseq | NP_659406 |
MIM | 300576 |
UniProt ID | Q96MV8 |
◆ Recombinant Proteins | ||
ZDHHC15-6316R | Recombinant Rat ZDHHC15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZDHHC15-6660R | Recombinant Rat ZDHHC15 Protein | +Inquiry |
ZDHHC15-676H | Recombinant Human ZDHHC15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZDHHC15-3791H | Recombinant Human ZDHHC15, GST-tagged | +Inquiry |
ZDHHC15-5278R | Recombinant Rhesus monkey ZDHHC15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC15-195HCL | Recombinant Human ZDHHC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC15 Products
Required fields are marked with *
My Review for All ZDHHC15 Products
Required fields are marked with *
0
Inquiry Basket