Recombinant Human ZDHHC15 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZDHHC15-676H
• Product Overview: ZDHHC15 MS Standard C13 and N15-labeled recombinant protein (NP_659406) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 39.2 kDa
• AA Sequence: MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETETTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZDHHC15 zinc finger DHHC-type palmitoyltransferase 15 [ Homo sapiens (human) ]
• Official Symbol: ZDHHC15
• Synonyms: ZDHHC15; zinc finger DHHC-type palmitoyltransferase 15; MRX91; DHHC15; palmitoyltransferase ZDHHC15; DHHC-15; acyltransferase ZDHHC15; zinc finger DHHC domain-containing protein 15; zinc finger DHHC-type containing 15; zinc finger, DHHC domain containing 15; EC 2.3.1.225
• Gene ID: 158866
• mRNA Refseq: NM_144969
• Protein Refseq: NP_659406
• MIM: 300576
• UniProt ID: Q96MV8