Recombinant Human ZDHHC8 Protein (1-42), N-GST tagged
Cat.No. : | ZDHHC8-01H |
Product Overview : | Human ZDHHC8 full-length ORF ( AAH09442, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-42 |
Description : | This gene encodes a four transmembrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein may function as a palmitoyltransferase. Defects in this gene may be associated with a susceptibility to schizophrenia. Alternate splicing of this gene results in multiple transcript variants. A pseudogene of this gene is found on chromosome 22. |
Molecular Mass : | 30.36 kDa |
AA Sequence : | MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ZDHHC8 zinc finger DHHC-type palmitoyltransferase 8 [ Homo sapiens (human) ] |
Official Symbol | ZDHHC8 |
Synonyms | ZDHHC8; zinc finger DHHC-type palmitoyltransferase 8; DHHC8; ZNF378; ZDHHCL1; palmitoyltransferase ZDHHC8; membrane-associated DHHC8 zinc finger protein; zinc finger DHHC-type containing 8; zinc finger protein 378; zinc finger, DHHC domain like containing 1; EC 2.3.1.225 |
Gene ID | 29801 |
mRNA Refseq | NM_013373 |
Protein Refseq | NP_037505 |
MIM | 608784 |
UniProt ID | Q2TGE9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC8 Products
Required fields are marked with *
My Review for All ZDHHC8 Products
Required fields are marked with *
0
Inquiry Basket