Recombinant Human ZDHHC8 Protein (1-42), N-GST tagged

Cat.No. : ZDHHC8-01H
Product Overview : Human ZDHHC8 full-length ORF ( AAH09442, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-42
Description : This gene encodes a four transmembrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein may function as a palmitoyltransferase. Defects in this gene may be associated with a susceptibility to schizophrenia. Alternate splicing of this gene results in multiple transcript variants. A pseudogene of this gene is found on chromosome 22.
Molecular Mass : 30.36 kDa
AA Sequence : MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZDHHC8 zinc finger DHHC-type palmitoyltransferase 8 [ Homo sapiens (human) ]
Official Symbol ZDHHC8
Synonyms ZDHHC8; zinc finger DHHC-type palmitoyltransferase 8; DHHC8; ZNF378; ZDHHCL1; palmitoyltransferase ZDHHC8; membrane-associated DHHC8 zinc finger protein; zinc finger DHHC-type containing 8; zinc finger protein 378; zinc finger, DHHC domain like containing 1; EC 2.3.1.225
Gene ID 29801
mRNA Refseq NM_013373
Protein Refseq NP_037505
MIM 608784
UniProt ID Q2TGE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZDHHC8 Products

Required fields are marked with *

My Review for All ZDHHC8 Products

Required fields are marked with *

0
cart-icon