Recombinant Human ZDHHC8 Protein (1-42), N-GST tagged

• Cat.No.: ZDHHC8-01H
• Product Overview: Human ZDHHC8 full-length ORF ( AAH09442, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a four transmembrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein may function as a palmitoyltransferase. Defects in this gene may be associated with a susceptibility to schizophrenia. Alternate splicing of this gene results in multiple transcript variants. A pseudogene of this gene is found on chromosome 22.
• Source: Wheat Germ (in vitro)
• Species: Human
• Tag: N-GST
• Molecular Mass: 30.36 kDa
• Protein Length: 1-42
• AA Sequence: MDRGTQGPHRPSDTACGLPDRVSPARLLLTNALPFTDPAGSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ZDHHC8 zinc finger DHHC-type palmitoyltransferase 8 [ Homo sapiens (human) ]
• Official Symbol: ZDHHC8
• Synonyms: ZDHHC8; zinc finger DHHC-type palmitoyltransferase 8; DHHC8; ZNF378; ZDHHCL1; palmitoyltransferase ZDHHC8; membrane-associated DHHC8 zinc finger protein; zinc finger DHHC-type containing 8; zinc finger protein 378; zinc finger, DHHC domain like containing 1; EC 2.3.1.225
• Gene ID: 29801
• mRNA Refseq: NM_013373
• Protein Refseq: NP_037505
• MIM: 608784
• UniProt ID: Q2TGE9