Recombinant Human ZFAND2B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZFAND2B-2560H |
Product Overview : | ZFAND2B MS Standard C13 and N15-labeled recombinant protein (NP_620157) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 28 kDa |
AA Sequence : | MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZFAND2B zinc finger AN1-type containing 2B [ Homo sapiens (human) ] |
Official Symbol | ZFAND2B |
Synonyms | ZFAND2B; zinc finger, AN1-type domain 2B; zinc finger, AN1 type 2B; AN1-type zinc finger protein 2B; AIRAPL; arsenite inducible RNA associated protein like; AIRAP-like protein; zinc finger, AN1-type 2B; arsenite-inducible RNA-associated protein-like protein; |
Gene ID | 130617 |
mRNA Refseq | NM_138802 |
Protein Refseq | NP_620157 |
MIM | 613474 |
UniProt ID | Q8WV99 |
◆ Recombinant Proteins | ||
ZFAND2B-6668R | Recombinant Rat ZFAND2B Protein | +Inquiry |
ZFAND2B-10329M | Recombinant Mouse ZFAND2B Protein, His (Fc)-Avi-tagged | +Inquiry |
ZFAND2B-5286R | Recombinant Rhesus monkey ZFAND2B Protein, His-tagged | +Inquiry |
ZFAND2B-5099R | Recombinant Rhesus Macaque ZFAND2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Zfand2b-7075M | Recombinant Mouse Zfand2b Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFAND2B-187HCL | Recombinant Human ZFAND2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZFAND2B Products
Required fields are marked with *
My Review for All ZFAND2B Products
Required fields are marked with *