Recombinant Human ZFAND5 protein, GST-tagged
| Cat.No. : | ZFAND5-6744H |
| Product Overview : | Recombinant Human ZFAND5 protein(75-141 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 75-141 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | NCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ZFAND5 zinc finger, AN1-type domain 5 [ Homo sapiens ] |
| Official Symbol | ZFAND5 |
| Synonyms | ZFAND5; zinc finger, AN1-type domain 5; ZA20D2, zinc finger protein 216 , zinc finger, A20 domain containing 2 , ZNF216; AN1-type zinc finger protein 5; ZFAND5A; zinc finger protein 216; zinc finger, A20 domain containing 2; zinc finger A20 domain-containing protein 2; ZA20D2; ZNF216; |
| Gene ID | 7763 |
| mRNA Refseq | NM_001102420 |
| Protein Refseq | NP_001095890 |
| MIM | 604761 |
| UniProt ID | O76080 |
| ◆ Recombinant Proteins | ||
| ZFAND5-5312H | Recombinant Human ZFAND5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ZFAND5-312H | Recombinant Human ZFAND5 Protein, DDK-tagged | +Inquiry |
| ZFAND5-3447H | Recombinant Human ZFAND5, His-tagged | +Inquiry |
| ZFAND5-6744H | Recombinant Human ZFAND5 protein, GST-tagged | +Inquiry |
| ZFAND5-0593H | Recombinant Human ZFAND5 Protein (A2-I213), His/StrepII tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZFAND5-185HCL | Recombinant Human ZFAND5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZFAND5 Products
Required fields are marked with *
My Review for All ZFAND5 Products
Required fields are marked with *
