Recombinant Human ZFAND5 protein, GST-tagged

• Cat.No.: ZFAND5-6744H
• Product Overview: Recombinant Human ZFAND5 protein(75-141 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 75-141 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: NCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ZFAND5 zinc finger, AN1-type domain 5 [ Homo sapiens ]
• Official Symbol: ZFAND5
• Synonyms: ZFAND5; zinc finger, AN1-type domain 5; ZA20D2, zinc finger protein 216 , zinc finger, A20 domain containing 2 , ZNF216; AN1-type zinc finger protein 5; ZFAND5A; zinc finger protein 216; zinc finger, A20 domain containing 2; zinc finger A20 domain-containing protein 2; ZA20D2; ZNF216
• Gene ID: 7763
• mRNA Refseq: NM_001102420
• Protein Refseq: NP_001095890
• MIM: 604761
• UniProt ID: O76080