"ZFP36L1" Related Products

Expand
Expand

Recombinant Human ZFP36L1 protein, GST-tagged

Cat.No.: ZFP36L1-3801H
Product Overview: Recombinant Human ZFP36L1(1 a.a. - 108 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.62 kDa
AA Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEP APALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: ZFP36L1 zinc finger protein 36, C3H type-like 1 [ Homo sapiens ]
Official Symbol: ZFP36L1
Synonyms: ZFP36L1; zinc finger protein 36, C3H type-like 1; BRF1, zinc finger protein, C3H type, 36 like 1; zinc finger protein 36, C3H1 type-like 1; Berg36; cMG1; ERF1; RNF162B; TIS11B; EGF-response factor 1; butyrate response factor 1; early response factor Berg36; zinc finger protein, C3H type, 36-like 1; BRF1; ERF-1;
Gene ID: 677
mRNA Refseq: NM_004926
Protein Refseq: NP_004917
MIM: 601064
UniProt ID: Q07352
Chromosome Location: 14q22-q24
Pathway: Destabilization of mRNA by Butyrate Response Factor 1 (BRF1), organism-specific biosystem; Gene Expression, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; Validated targets of C-MYC transcriptional repression, organism-specific biosystem;
Function: AU-rich element binding; DNA binding; mRNA binding; metal ion binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.