Recombinant Human ZFYVE21, His-tagged
| Cat.No. : | ZFYVE21-31655TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 134-234 of Human ZFYVE21 with N terminal His tag; 101 amino acids, 23kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 134-234 a.a. |
| Description : | ZFYVE21 contains one FYVE-type zinc finger. Its function is unknown. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 99 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ETMTCRLSNNQRYLFLDGDSHYEIEIVHISTVQILTEGFP PGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVGR RQAVAWLVAMHKAAKLLYESRDQ |
| Gene Name | ZFYVE21 zinc finger, FYVE domain containing 21 [ Homo sapiens ] |
| Official Symbol | ZFYVE21 |
| Synonyms | ZFYVE21; zinc finger, FYVE domain containing 21; zinc finger FYVE domain-containing protein 21; MGC2550; ZF21; |
| Gene ID | 79038 |
| mRNA Refseq | NM_024071 |
| Protein Refseq | NP_076976 |
| MIM | 613504 |
| Uniprot ID | Q9BQ24 |
| Chromosome Location | 14q32.33 |
| Function | metal ion binding; |
| ◆ Recombinant Proteins | ||
| ZFYVE21-31655TH | Recombinant Human ZFYVE21, His-tagged | +Inquiry |
| ZFYVE21-10371M | Recombinant Mouse ZFYVE21 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Zfyve21-7103M | Recombinant Mouse Zfyve21 Protein, Myc/DDK-tagged | +Inquiry |
| ZFYVE21-19166M | Recombinant Mouse ZFYVE21 Protein | +Inquiry |
| ZFYVE21-7476Z | Recombinant Zebrafish ZFYVE21 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZFYVE21-174HCL | Recombinant Human ZFYVE21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZFYVE21 Products
Required fields are marked with *
My Review for All ZFYVE21 Products
Required fields are marked with *
