Recombinant Human ZG16 protein, His-tagged
Cat.No. : | ZG16-562H |
Product Overview : | Recombinant Human ZG16 protein(NP_689551.3)(1-167 aa), fused to His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-167 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | ZG16 zymogen granule protein 16 [ Homo sapiens (human) ] |
Official Symbol | ZG16 |
Synonyms | JCLN; JCLN1; ZG16A |
Gene ID | 653808 |
mRNA Refseq | NM_152338.4 |
Protein Refseq | NP_689551.3 |
MIM | 617311 |
UniProt ID | O60844 |
◆ Recombinant Proteins | ||
ZG16-202H | Recombinant Human ZG16, His-tagged | +Inquiry |
ZG16-4323H | Recombinant Human ZG16 Protein, His (Fc)-Avi-tagged | +Inquiry |
Zg16-7105M | Recombinant Mouse Zg16 Protein, Myc/DDK-tagged | +Inquiry |
ZG16-5919HF | Recombinant Full Length Human ZG16 Protein, GST-tagged | +Inquiry |
ZG16-6336R | Recombinant Rat ZG16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZG16-171HCL | Recombinant Human ZG16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZG16 Products
Required fields are marked with *
My Review for All ZG16 Products
Required fields are marked with *