Recombinant Human ZG16 protein, His-tagged
| Cat.No. : | ZG16-562H |
| Product Overview : | Recombinant Human ZG16 protein(NP_689551.3)(1-167 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-167 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | ZG16 zymogen granule protein 16 [ Homo sapiens (human) ] |
| Official Symbol | ZG16 |
| Synonyms | JCLN; JCLN1; ZG16A |
| Gene ID | 653808 |
| mRNA Refseq | NM_152338.4 |
| Protein Refseq | NP_689551.3 |
| MIM | 617311 |
| UniProt ID | O60844 |
| ◆ Recombinant Proteins | ||
| ZG16-1524H | Recombinant Human ZG16 | +Inquiry |
| ZG16-522H | Recombinant Human zymogen granule protein 16, His-tagged | +Inquiry |
| ZG16-5123H | Recombinant Human ZG16, His-tagged | +Inquiry |
| ZG16-6336R | Recombinant Rat ZG16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZG16-4757H | Recombinant Human ZG16 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZG16-171HCL | Recombinant Human ZG16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZG16 Products
Required fields are marked with *
My Review for All ZG16 Products
Required fields are marked with *
