Recombinant Human ZHX3 protein, GST-tagged
Cat.No. : | ZHX3-3721H |
Product Overview : | Recombinant Human ZHX3 protein(848-956 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 848-956 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | ELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLETD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZHX3 zinc fingers and homeoboxes 3 [ Homo sapiens ] |
Official Symbol | ZHX3 |
Synonyms | ZHX3; zinc fingers and homeoboxes 3; TIX1, triple homeobox 1; zinc fingers and homeoboxes protein 3; KIAA0395; triple homeobox 1; triple homeobox protein 1; zinc finger and homeodomain protein 3; TIX1; |
Gene ID | 23051 |
mRNA Refseq | NM_015035 |
Protein Refseq | NP_055850 |
MIM | 609598 |
UniProt ID | Q9H4I2 |
◆ Recombinant Proteins | ||
Zhx3-7108M | Recombinant Mouse Zhx3 Protein, Myc/DDK-tagged | +Inquiry |
ZHX3-6707R | Recombinant Rat ZHX3 Protein | +Inquiry |
ZHX3-9847Z | Recombinant Zebrafish ZHX3 | +Inquiry |
ZHX3-6339R | Recombinant Rat ZHX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZHX3-3721H | Recombinant Human ZHX3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZHX3-1983HCL | Recombinant Human ZHX3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZHX3 Products
Required fields are marked with *
My Review for All ZHX3 Products
Required fields are marked with *
0
Inquiry Basket