Recombinant Human ZHX3 protein, GST-tagged
| Cat.No. : | ZHX3-3721H |
| Product Overview : | Recombinant Human ZHX3 protein(848-956 aa), fused to GST tag, was expressed in E. coli. |
| Availability | October 31, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 848-956 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | ELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLETD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ZHX3 zinc fingers and homeoboxes 3 [ Homo sapiens ] |
| Official Symbol | ZHX3 |
| Synonyms | ZHX3; zinc fingers and homeoboxes 3; TIX1, triple homeobox 1; zinc fingers and homeoboxes protein 3; KIAA0395; triple homeobox 1; triple homeobox protein 1; zinc finger and homeodomain protein 3; TIX1; |
| Gene ID | 23051 |
| mRNA Refseq | NM_015035 |
| Protein Refseq | NP_055850 |
| MIM | 609598 |
| UniProt ID | Q9H4I2 |
| ◆ Recombinant Proteins | ||
| ZHX3-5293R | Recombinant Rhesus monkey ZHX3 Protein, His-tagged | +Inquiry |
| ZHX3-6707R | Recombinant Rat ZHX3 Protein | +Inquiry |
| ZHX3-3721H | Recombinant Human ZHX3 protein, GST-tagged | +Inquiry |
| ZHX3-6339R | Recombinant Rat ZHX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Zhx3-7108M | Recombinant Mouse Zhx3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZHX3-1983HCL | Recombinant Human ZHX3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZHX3 Products
Required fields are marked with *
My Review for All ZHX3 Products
Required fields are marked with *
