Recombinant Human ZIC1

Cat.No. : ZIC1-31656TH
Product Overview : Recombinant fragment corresponding to amino acids 2-95 of Human Zic1 with a proprietary tag: Predicted MWt 35.97 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 94 amino acids
Description : This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene.
Molecular Weight : 35.970kDa inclusive of tags
Tissue specificity : CNS. A high level expression is seen in the cerebellum. Detected in the nuclei of the cerebellar granule cell lineage from the progenitor cells of the external germinal layer to the postmigrated cells of the internal granular layer. Detected in medullobla
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN
Sequence Similarities : Belongs to the GLI C2H2-type zinc-finger protein family.Contains 5 C2H2-type zinc fingers.
Gene Name ZIC1 Zic family member 1 [ Homo sapiens ]
Official Symbol ZIC1
Synonyms ZIC1; Zic family member 1; Zic family member 1 (odd paired Drosophila homolog) , Zic family member 1 (odd paired homolog, Drosophila); zinc finger protein ZIC 1; ZIC; ZNF201;
Gene ID 7545
mRNA Refseq NM_003412
Protein Refseq NP_003403
MIM 600470
Uniprot ID Q15915
Chromosome Location 3q24
Function DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZIC1 Products

Required fields are marked with *

My Review for All ZIC1 Products

Required fields are marked with *

0
cart-icon