Recombinant Human ZIC1
Cat.No. : | ZIC1-31656TH |
Product Overview : | Recombinant fragment corresponding to amino acids 2-95 of Human Zic1 with a proprietary tag: Predicted MWt 35.97 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 94 amino acids |
Description : | This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. |
Molecular Weight : | 35.970kDa inclusive of tags |
Tissue specificity : | CNS. A high level expression is seen in the cerebellum. Detected in the nuclei of the cerebellar granule cell lineage from the progenitor cells of the external germinal layer to the postmigrated cells of the internal granular layer. Detected in medullobla |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFN |
Sequence Similarities : | Belongs to the GLI C2H2-type zinc-finger protein family.Contains 5 C2H2-type zinc fingers. |
Gene Name | ZIC1 Zic family member 1 [ Homo sapiens ] |
Official Symbol | ZIC1 |
Synonyms | ZIC1; Zic family member 1; Zic family member 1 (odd paired Drosophila homolog) , Zic family member 1 (odd paired homolog, Drosophila); zinc finger protein ZIC 1; ZIC; ZNF201; |
Gene ID | 7545 |
mRNA Refseq | NM_003412 |
Protein Refseq | NP_003403 |
MIM | 600470 |
Uniprot ID | Q15915 |
Chromosome Location | 3q24 |
Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
ZIC1-19176M | Recombinant Mouse ZIC1 Protein | +Inquiry |
ZIC1-10379M | Recombinant Mouse ZIC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZIC1-31656TH | Recombinant Human ZIC1 | +Inquiry |
ZIC1-440H | Recombinant Human ZIC1 Protein, His-tagged | +Inquiry |
ZIC1-8574Z | Recombinant Zebrafish ZIC1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZIC1 Products
Required fields are marked with *
My Review for All ZIC1 Products
Required fields are marked with *