Recombinant Human Zinc Finger Protein 259, GST-Tagged
Cat.No. : | ZNF259-6946H |
Product Overview : | HumanZNF259 recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Zinc finger proteinZPR1 is a protein that in humans is encoded by the ZNF259 gene |
MW : | 36.63 kDa |
Purity : | GlutathioneSepharose 4 Fast Flow |
Sequence : | IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR |
Buffer : | 50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer |
Storage : | Store at-80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ZNF259zinc finger protein 259 [ Homo sapiens ] |
Official Symbol | ZNF259 |
Synonyms | ZNF259; zinc finger protein 259;zinc finger protein ZPR1; ZPR1 |
Gene ID | 8882 |
mRNA Refseq | NM_003904 |
Protein Refseq | NP_003895 |
MIM | 603901 |
Uniprot ID | O75312 |
Chromosome Location | 11q23.3 |
Pathway | EGFR1 Signaling Pathway,organism-specific biosystem |
Function | metal ion binding; zinc ion binding |
◆ Recombinant Proteins | ||
ZNF259-10405M | Recombinant Mouse ZNF259 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF259-30759TH | Recombinant Human ZNF259, His-tagged | +Inquiry |
ZNF259-6944H | Recombinant Human Zinc Finger Protein 259, His-tagged | +Inquiry |
ZNF259-6946H | Recombinant Human Zinc Finger Protein 259, GST-Tagged | +Inquiry |
ZNF259-6943H | Recombinant Human Zinc Finger Protein 259, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF259-108HCL | Recombinant Human ZNF259 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF259 Products
Required fields are marked with *
My Review for All ZNF259 Products
Required fields are marked with *