Recombinant Human ZMAT4 protein, GST-tagged
Cat.No. : | ZMAT4-301228H |
Product Overview : | Recombinant Human ZMAT4 protein(105-153 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 105-153 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | LLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ZMAT4 zinc finger, matrin-type 4 [ Homo sapiens ] |
Official Symbol | ZMAT4 |
Synonyms | ZMAT4; zinc finger, matrin-type 4; zinc finger matrin-type protein 4; FLJ13842; zinc finger, matrin type 4; |
mRNA Refseq | NM_001135731 |
Protein Refseq | NP_001129203 |
UniProt ID | Q9H898 |
Gene ID | 79698 |
◆ Recombinant Proteins | ||
Zmat4-7116M | Recombinant Mouse Zmat4 Protein, Myc/DDK-tagged | +Inquiry |
ZMAT4-10388M | Recombinant Mouse ZMAT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMAT4-1099C | Recombinant Cynomolgus ZMAT4 Protein, His-tagged | +Inquiry |
ZMAT4-3888H | Recombinant Human ZMAT4 protein, His-tagged | +Inquiry |
ZMAT4-301228H | Recombinant Human ZMAT4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZMAT4-156HCL | Recombinant Human ZMAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZMAT4 Products
Required fields are marked with *
My Review for All ZMAT4 Products
Required fields are marked with *