Recombinant Human ZMAT5 protein, His-tagged
Cat.No. : | ZMAT5-2587H |
Product Overview : | Recombinant Human ZMAT5 protein(1-170 aa), fused to His tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-170 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZMAT5 zinc finger, matrin-type 5 [ Homo sapiens ] |
Official Symbol | ZMAT5 |
Synonyms | ZMAT5; zinc finger, matrin-type 5; zinc finger matrin-type protein 5; U11/U12 snRNP 20K; U11/U12-20K; zinc finger, matrin type 5; U11/U12 snRNP 20 kDa protein; U11/U12 small nuclear ribonucleoprotein 20 kDa protein; |
Gene ID | 55954 |
mRNA Refseq | NM_001003692 |
Protein Refseq | NP_001003692 |
UniProt ID | Q9UDW3 |
◆ Recombinant Proteins | ||
ZMAT5-10389M | Recombinant Mouse ZMAT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMAT5-2587H | Recombinant Human ZMAT5 protein, His-tagged | +Inquiry |
ZMAT5-4905C | Recombinant Chicken ZMAT5 | +Inquiry |
ZMAT5-19195M | Recombinant Mouse ZMAT5 Protein | +Inquiry |
ZMAT5-4904C | Recombinant Chicken ZMAT5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZMAT5-155HCL | Recombinant Human ZMAT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZMAT5 Products
Required fields are marked with *
My Review for All ZMAT5 Products
Required fields are marked with *