Recombinant Human ZMYM2 protein, GST-tagged
Cat.No. : | ZMYM2-5744H |
Product Overview : | Recombinant Human ZMYM2 protein(Q9UBW7)(423-466aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 423-466a.a. |
Tag : | GST |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNC |
Gene Name | ZMYM2 zinc finger, MYM-type 2 [ Homo sapiens ] |
Official Symbol | ZMYM2 |
Synonyms | ZMYM2; zinc finger, MYM-type 2; zinc finger protein 198 , ZNF198; zinc finger MYM-type protein 2; FIM; MYM; RAMP; zinc finger protein 198; fused in myeloproliferative disorders protein; rearranged in an atypical myeloproliferative disorder; SCLL; ZNF198; |
Gene ID | 7750 |
mRNA Refseq | NM_001190964 |
Protein Refseq | NP_001177893 |
MIM | 602221 |
UniProt ID | Q9UBW7 |
◆ Recombinant Proteins | ||
ZMYM2-5744H | Recombinant Human ZMYM2 protein, GST-tagged | +Inquiry |
ZMYM2-10391M | Recombinant Mouse ZMYM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMYM2-5299R | Recombinant Rhesus monkey ZMYM2 Protein, His-tagged | +Inquiry |
ZMYM2-5112R | Recombinant Rhesus Macaque ZMYM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMYM2-19200M | Recombinant Mouse ZMYM2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZMYM2 Products
Required fields are marked with *
My Review for All ZMYM2 Products
Required fields are marked with *