Recombinant Human ZMYM2 protein, GST-tagged

• Cat.No.: ZMYM2-5744H
• Product Overview: Recombinant Human ZMYM2 protein(Q9UBW7)(423-466aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 423-466a.a.
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNC

Gene Information

• Gene Name: ZMYM2 zinc finger, MYM-type 2 [ Homo sapiens ]
• Official Symbol: ZMYM2
• Synonyms: ZMYM2; zinc finger, MYM-type 2; zinc finger protein 198 , ZNF198; zinc finger MYM-type protein 2; FIM; MYM; RAMP; zinc finger protein 198; fused in myeloproliferative disorders protein; rearranged in an atypical myeloproliferative disorder; SCLL; ZNF198
• Gene ID: 7750
• mRNA Refseq: NM_001190964
• Protein Refseq: NP_001177893
• MIM: 602221
• UniProt ID: Q9UBW7