Recombinant Human ZMYND19 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZMYND19-1393H
• Product Overview: ZMYND19 MS Standard C13 and N15-labeled recombinant protein (NP_612471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1, and to the N termini of alpha-tubulin, and beta-tubulin.
• Molecular Mass: 26.4 kDa
• AA Sequence: MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPERTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZMYND19 zinc finger MYND-type containing 19 [ Homo sapiens (human) ]
• Official Symbol: ZMYND19
• Synonyms: ZMYND19; zinc finger, MYND-type containing 19; zinc finger MYND domain-containing protein 19; MIZIP; MCH-R1-interacting zinc finger protein; zinc finger, MYND domain containing 19; melanin-concentrating hormone receptor 1 interacting zinc-finger protein; melanin-concentrating hormone receptor 1-interacting zinc finger protein; RP11-48C7.4
• Gene ID: 116225
• mRNA Refseq: NM_138462
• Protein Refseq: NP_612471
• MIM: 611424
• UniProt ID: Q96E35