Recombinant Human ZMYND19 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZMYND19-1393H
Product Overview : ZMYND19 MS Standard C13 and N15-labeled recombinant protein (NP_612471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1, and to the N termini of alpha-tubulin, and beta-tubulin.
Molecular Mass : 26.4 kDa
AA Sequence : MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPERTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZMYND19 zinc finger MYND-type containing 19 [ Homo sapiens (human) ]
Official Symbol ZMYND19
Synonyms ZMYND19; zinc finger, MYND-type containing 19; zinc finger MYND domain-containing protein 19; MIZIP; MCH-R1-interacting zinc finger protein; zinc finger, MYND domain containing 19; melanin-concentrating hormone receptor 1 interacting zinc-finger protein; melanin-concentrating hormone receptor 1-interacting zinc finger protein; RP11-48C7.4;
Gene ID 116225
mRNA Refseq NM_138462
Protein Refseq NP_612471
MIM 611424
UniProt ID Q96E35

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZMYND19 Products

Required fields are marked with *

My Review for All ZMYND19 Products

Required fields are marked with *

0
cart-icon
0
compare icon