Recombinant Human ZNF160 Protein (1-147 aa), His-Myc-tagged
| Cat.No. : | ZNF160-2166H |
| Product Overview : | Recombinant Human ZNF160 Protein (1-147 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-147 aa |
| Description : | May be involved in transcriptional regulation. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 22.1 kDa |
| AA Sequence : | MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | ZNF160 zinc finger protein 160 [ Homo sapiens (human) ] |
| Official Symbol | ZNF160 |
| Synonyms | ZNF160; F11; HZF5; KR18; HKr18; |
| Gene ID | 90338 |
| mRNA Refseq | NM_001102603 |
| Protein Refseq | NP_001096073 |
| UniProt ID | Q9HCG1 |
| ◆ Recombinant Proteins | ||
| ZNF160-2166H | Recombinant Human ZNF160 Protein (1-147 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF160 Products
Required fields are marked with *
My Review for All ZNF160 Products
Required fields are marked with *
