Recombinant Human ZNF160 Protein (1-147 aa), His-Myc-tagged

Cat.No. : ZNF160-2166H
Product Overview : Recombinant Human ZNF160 Protein (1-147 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Isoform 2.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-147 aa
Description : May be involved in transcriptional regulation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.1 kDa
AA Sequence : MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name ZNF160 zinc finger protein 160 [ Homo sapiens (human) ]
Official Symbol ZNF160
Synonyms ZNF160; F11; HZF5; KR18; HKr18;
Gene ID 90338
mRNA Refseq NM_001102603
Protein Refseq NP_001096073
UniProt ID Q9HCG1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF160 Products

Required fields are marked with *

My Review for All ZNF160 Products

Required fields are marked with *

0
cart-icon