Recombinant Human ZNF174, His-tagged
Cat.No. : | ZNF174-30755TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 75-407 of Human ZNF174 with N terminal His tag; Predicted MWt 39 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 75-407 a.a. |
Description : | ZNF174 is a transcriptional repressor. Expressed in a variety of organs, but most strongly in adult testis and ovary followed by small intestine, colon, prostate, thymus, spleen, pancreas, skeletal muscle, heart, brain and kidney. Also expressed in umbilical vein endothelial cells, foreskin fibroblast and HEPG2 cells. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 60 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSS KEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQ LGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPH HWEKSPLLQEPTPKLAGTEAPRMRSDNKENPQQEGAKG AKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVSSPN AQKPFAHYQRHCRVEYISSPLKSHPLRELKKSKGGKRS LSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRH KRVHTGERPYTCGECGNCFGRQSTLKLHQRIHTGEKPY QCGQCGKSFRQSSNLHQHHRLHHGD |
Gene Name | ZNF174 zinc finger protein 174 [ Homo sapiens ] |
Official Symbol | ZNF174 |
Synonyms | ZNF174; zinc finger protein 174; ZSCAN8; |
Gene ID | 7727 |
mRNA Refseq | NM_001032292 |
Protein Refseq | NP_001027463 |
MIM | 603900 |
Uniprot ID | Q15697 |
Chromosome Location | 16p13 |
Function | DNA binding; metal ion binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
ZNF174-5504H | Recombinant Human ZNF174 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF174-5305R | Recombinant Rhesus monkey ZNF174 Protein, His-tagged | +Inquiry |
Zfp174-7079M | Recombinant Mouse Zfp174 Protein, Myc/DDK-tagged | +Inquiry |
ZNF174-5118R | Recombinant Rhesus Macaque ZNF174 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF174-30755TH | Recombinant Human ZNF174, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF174-136HCL | Recombinant Human ZNF174 293 Cell Lysate | +Inquiry |
ZNF174-135HCL | Recombinant Human ZNF174 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF174 Products
Required fields are marked with *
My Review for All ZNF174 Products
Required fields are marked with *