Recombinant Human ZNF180 protein, His-tagged
| Cat.No. : | ZNF180-2897H | 
| Product Overview : | Recombinant Human ZNF180 protein(1-349 aa), fused to His tag, was expressed in E. coli. | 
| Availability | November 04, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-349 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AA Sequence : | MRRVYAGSWKRCAAQDLSTLLCLEESMEEQDEKPPEPPKACAQDSFLPQEIIIKVEGEDTGSLTIPSQEGVNFKIVTVDFTREEQGTWNPAQRTLDRDVILENHRDLVSWDLATAVGKKDSTSKQRIFDEEPANGVKIERFTRDDPWLSSCEEVDDCKDQLEKQQEKQEILLQEVAFTQRKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNHFHKHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQTKDKCYGFSDRIQSFCHGTPLHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHSSSLTQNMRNNSEE | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.  | 
                                
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.  | 
                                
| Gene Name | ZNF180 zinc finger protein 180 [ Homo sapiens ] | 
| Official Symbol | ZNF180 | 
| Synonyms | ZNF180; zinc finger protein 180; zinc finger protein 180 (HHZ168); HHZ168; | 
| Gene ID | 7733 | 
| mRNA Refseq | NM_013256 | 
| Protein Refseq | NP_037388 | 
| MIM | 606740 | 
| UniProt ID | Q9UJW8 | 
| ◆ Recombinant Proteins | ||
| ZNF180-2897H | Recombinant Human ZNF180 protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ZNF180-132HCL | Recombinant Human ZNF180 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ZNF180 Products
Required fields are marked with *
My Review for All ZNF180 Products
Required fields are marked with *
  
        
    
      
            