Recombinant Human ZNF280A protein, GST-tagged
Cat.No. : | ZNF280A-9755H |
Product Overview : | Recombinant Human ZNF280A protein(461-542 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 461-542 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | LTLKEEIEHKTKDHQTFKKPEQLQGLPSETKVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKKTAMNTRDSRLPCSKDSS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ZNF280A zinc finger protein 280A [ Homo sapiens ] |
Official Symbol | ZNF280A |
Synonyms | ZNF280A; zinc finger protein 280A; SUHW1, suppressor of hairy wing homolog 1 (Drosophila) , zinc finger protein 280 , ZNF280; 3OY11.1; ZNF636; zinc finger protein 280; zinc finger protein 636; suppressor of hairy wing homolog 1; SUHW1; ZNF280; |
Gene ID | 129025 |
mRNA Refseq | NM_080740 |
Protein Refseq | NP_542778 |
UniProt ID | P59817 |
◆ Recombinant Proteins | ||
ZNF280A-346H | Recombinant Human ZNF280A Protein, His-tagged | +Inquiry |
ZNF280A-9755H | Recombinant Human ZNF280A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF280A-103HCL | Recombinant Human ZNF280A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF280A Products
Required fields are marked with *
My Review for All ZNF280A Products
Required fields are marked with *
0
Inquiry Basket