Recombinant Human ZNF280A protein, GST-tagged

• Cat.No.: ZNF280A-9755H
• Product Overview: Recombinant Human ZNF280A protein(461-542 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 461-542 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: LTLKEEIEHKTKDHQTFKKPEQLQGLPSETKVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKKTAMNTRDSRLPCSKDSS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ZNF280A zinc finger protein 280A [ Homo sapiens ]
• Official Symbol: ZNF280A
• Synonyms: ZNF280A; zinc finger protein 280A; SUHW1, suppressor of hairy wing homolog 1 (Drosophila) , zinc finger protein 280 , ZNF280; 3OY11.1; ZNF636; zinc finger protein 280; zinc finger protein 636; suppressor of hairy wing homolog 1; SUHW1; ZNF280
• Gene ID: 129025
• mRNA Refseq: NM_080740
• Protein Refseq: NP_542778
• UniProt ID: P59817