Recombinant Human ZNF320 protein, GST-tagged
Cat.No. : | ZNF320-1842H |
Product Overview : | Recombinant Human ZNF320 protein(190-238 aa), fused to GST tag, was expressed in E. coli. |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
ProteinLength : | 190-238 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | KCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZNF320 zinc finger protein 320 [ Homo sapiens ] |
Official Symbol | ZNF320 |
Synonyms | ZNF320; zinc finger protein 320; DKFZp686G16228; ZFPL; |
Gene ID | 117040 |
MIM | 606427 |
UniProt ID | A2RRD8 |
◆ Recombinant Proteins | ||
PRNPB-2098Z | Recombinant Zebrafish PRNPB | +Inquiry |
EPB41L5-4265HF | Recombinant Full Length Human EPB41L5 Protein, GST-tagged | +Inquiry |
EGFR-3803HF | Recombinant Human EGFR Protein, His-tagged, FITC conjugated | +Inquiry |
SERPINE1-5496H | Recombinant Human Serpin Peptidase Inhibitor, Clade E (nexin, plasminogen activator inhibitor type 1), Member 1, Non-LRP-tagged | +Inquiry |
GNAZ-193H | Recombinant Human GNAZ protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GG-183H | Native Human Gamma Globulin | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
AVPI1-8558HCL | Recombinant Human AVPI1 293 Cell Lysate | +Inquiry |
HA-2663HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
GABRQ-6055HCL | Recombinant Human GABRQ 293 Cell Lysate | +Inquiry |
DLK2-536HCL | Recombinant Human DLK2 cell lysate | +Inquiry |
CCNB3-304HCL | Recombinant Human CCNB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF320 Products
Required fields are marked with *
My Review for All ZNF320 Products
Required fields are marked with *
0
Inquiry Basket