Recombinant Human ZNF320 protein, GST-tagged
Cat.No. : | ZNF320-1842H |
Product Overview : | Recombinant Human ZNF320 protein(190-238 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 190-238 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | KCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZNF320 zinc finger protein 320 [ Homo sapiens ] |
Official Symbol | ZNF320 |
Synonyms | ZNF320; zinc finger protein 320; DKFZp686G16228; ZFPL; |
Gene ID | 117040 |
MIM | 606427 |
UniProt ID | A2RRD8 |
◆ Recombinant Proteins | ||
ZNF320-1842H | Recombinant Human ZNF320 protein, GST-tagged | +Inquiry |
ZNF320-2530H | Recombinant Human ZNF320 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF320-96HCL | Recombinant Human ZNF320 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF320 Products
Required fields are marked with *
My Review for All ZNF320 Products
Required fields are marked with *