Recombinant Human ZNF395 protein, T7-tagged
Cat.No. : | ZNF395-170H |
Product Overview : | Recombinant human ZNF395 (513 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 513 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEV LKAPSTSGLQQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPP LEPGAQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISD SGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPN CGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTG LPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSA ACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRF LD |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro mSIN3A-HDAC1 complex regulations study using recombinant ZNF395 protein intracellular delivery method.2. May be used as enzymatic substrate protein for Kinase and ubiquitin assay.3. May be used for mapping ZNF395 protein binding partner in protein–protein interaction assay in B cells.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ZNF395 zinc finger protein 395 [ Homo sapiens ] |
Official Symbol | ZNF395 |
Synonyms | ZNF395; zinc finger protein 395; DKFZp434K1210; HDBP2; PBF; PRF 1; HD-regulating factor 2; papillomavirus-binding factor; papillomavirus regulatory factor 1; papillomavirus regulatory factor PRF-1; HD gene regulatory region-binding protein 2; huntington disease gene regulatory region-binding protein 2; Huntingtons disease gene regulatory region-binding protein 2; PRF1; PRF-1; HDBP-2; HDRF-2; Si-1-8-14; |
Gene ID | 55893 |
mRNA Refseq | NM_018660 |
Protein Refseq | NP_061130 |
MIM | 609494 |
UniProt ID | Q9H8N7 |
Chromosome Location | 8p21 |
Function | DNA binding; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
ZNF395-170H | Recombinant Human ZNF395 protein, T7-tagged | +Inquiry |
ZNF395-065H | Recombinant Human ZNF395 Protein, GST-HIS-tagged | +Inquiry |
ZNF395-3018H | Recombinant Human Zinc Finger Protein 395, T7-tagged | +Inquiry |
ZNF395-10460Z | Recombinant Zebrafish ZNF395 | +Inquiry |
ZNF395-30781TH | Recombinant Human ZNF395 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF395-80HCL | Recombinant Human ZNF395 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF395 Products
Required fields are marked with *
My Review for All ZNF395 Products
Required fields are marked with *
0
Inquiry Basket