Recombinant Human ZNF461 Protein, GST-tagged
Cat.No. : | ZNF461-4911H |
Product Overview : | Human GIOT-1 partial ORF ( NP_694989.2, 121 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 121-218 a.a. |
Description : | ZNF461 (Zinc Finger Protein 461) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding and transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZFP30. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ZNF461 zinc finger protein 461 [ Homo sapiens ] |
Official Symbol | ZNF461 |
Synonyms | ZNF461; zinc finger protein 461; GIOT 1; MGC33911; gonadotropin inducible transcription repressor 1; gonadotropin-inducible ovary transcription repressor 1; GIOT1; GIOT-1; |
Gene ID | 92283 |
mRNA Refseq | NM_153257 |
Protein Refseq | NP_694989 |
MIM | 608640 |
UniProt ID | Q8TAF7 |
◆ Recombinant Proteins | ||
ZNF461-4911H | Recombinant Human ZNF461 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF461-2030HCL | Recombinant Human ZNF461 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF461 Products
Required fields are marked with *
My Review for All ZNF461 Products
Required fields are marked with *
0
Inquiry Basket