Recombinant Human ZNF592 Protein (1-242 aa), GST-tagged

• Cat.No.: ZNF592-1198H
• Product Overview: Recombinant Human ZNF592 Protein (1-242 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-242 aa
• Description: May be involved in transcriptional regulation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.2 kDa
• AA Sequence: MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ZNF592 zinc finger protein 592 [ Homo sapiens ]
• Official Symbol: ZNF592
• Synonyms: ZNF592; CAMOS; KIAA0211; SCAR5; MGC138437; MGC138439
• Gene ID: 9640
• mRNA Refseq: NM_014630
• Protein Refseq: NP_055445
• MIM: 613624
• UniProt ID: Q92610