Recombinant Human ZNF592 Protein (1-242 aa), GST-tagged
Cat.No. : | ZNF592-1198H |
Product Overview : | Recombinant Human ZNF592 Protein (1-242 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-242 aa |
Description : | May be involved in transcriptional regulation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.2 kDa |
AA Sequence : | MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ZNF592 zinc finger protein 592 [ Homo sapiens ] |
Official Symbol | ZNF592 |
Synonyms | ZNF592; CAMOS; KIAA0211; SCAR5; MGC138437; MGC138439; |
Gene ID | 9640 |
mRNA Refseq | NM_014630 |
Protein Refseq | NP_055445 |
MIM | 613624 |
UniProt ID | Q92610 |
◆ Recombinant Proteins | ||
ZNF592-5157R | Recombinant Rhesus Macaque ZNF592 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF592-4233Z | Recombinant Zebrafish ZNF592 | +Inquiry |
ZNF592-1198H | Recombinant Human ZNF592 Protein (1-242 aa), GST-tagged | +Inquiry |
ZNF592-5344R | Recombinant Rhesus monkey ZNF592 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF592 Products
Required fields are marked with *
My Review for All ZNF592 Products
Required fields are marked with *
0
Inquiry Basket