Recombinant Human ZNF593 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZNF593-3442H |
Product Overview : | ZNF593 MS Standard C13 and N15-labeled recombinant protein (NP_056955) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins. |
Molecular Mass : | 13.2 kDa |
AA Sequence : | MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZNF593 zinc finger protein 593 [ Homo sapiens (human) ] |
Official Symbol | ZNF593 |
Synonyms | ZNF593; zinc finger protein 593; ZT86; zinc finger protein T86; |
Gene ID | 51042 |
mRNA Refseq | NM_015871 |
Protein Refseq | NP_056955 |
MIM | 616698 |
UniProt ID | O00488 |
◆ Recombinant Proteins | ||
ZNF593-5345R | Recombinant Rhesus monkey ZNF593 Protein, His-tagged | +Inquiry |
ZNF593-1452C | Recombinant Chicken ZNF593 | +Inquiry |
ZNF593-11073Z | Recombinant Zebrafish ZNF593 | +Inquiry |
ZNF593-2907H | Recombinant Human Zinc Finger Protein 593, His-tagged | +Inquiry |
ZNF593-3442H | Recombinant Human ZNF593 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF593-40HCL | Recombinant Human ZNF593 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF593 Products
Required fields are marked with *
My Review for All ZNF593 Products
Required fields are marked with *
0
Inquiry Basket