Recombinant Human ZNF784 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZNF784-379H |
Product Overview : | ZNF784 MS Standard C13 and N15-labeled recombinant protein (NP_976308) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May be involved in transcriptional regulation. [UniProtKB/Swiss-Prot Function] |
Molecular Mass : | 34.2 kDa |
AA Sequence : | MAAARPEAQSRSSPTPESRSQEPLDLVLVPDDCRPGTPPSDLIEIQVVKVTDTTLVPEPPEPGSFHCALCPAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFHGPGPGLGDSGGQLGSSAAEGSGSGCGVGDPAEEGRGETAKVKVEADQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZNF784 zinc finger protein 784 [ Homo sapiens (human) ] |
Official Symbol | ZNF784 |
Synonyms | ZNF784; zinc finger protein 784; MGC75238; |
Gene ID | 147808 |
mRNA Refseq | NM_203374 |
Protein Refseq | NP_976308 |
UniProt ID | Q8NCA9 |
◆ Recombinant Proteins | ||
Zfp784-7100M | Recombinant Mouse Zfp784 Protein, Myc/DDK-tagged | +Inquiry |
ZNF784-379H | Recombinant Human ZNF784 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF784-10HCL | Recombinant Human ZNF784 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF784 Products
Required fields are marked with *
My Review for All ZNF784 Products
Required fields are marked with *
0
Inquiry Basket