Recombinant Human ZNF784 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : ZNF784-379H
Product Overview : ZNF784 MS Standard C13 and N15-labeled recombinant protein (NP_976308) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May be involved in transcriptional regulation. [UniProtKB/Swiss-Prot Function]
Molecular Mass : 34.2 kDa
AA Sequence : MAAARPEAQSRSSPTPESRSQEPLDLVLVPDDCRPGTPPSDLIEIQVVKVTDTTLVPEPPEPGSFHCALCPAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFHGPGPGLGDSGGQLGSSAAEGSGSGCGVGDPAEEGRGETAKVKVEADQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZNF784 zinc finger protein 784 [ Homo sapiens (human) ]
Official Symbol ZNF784
Synonyms ZNF784; zinc finger protein 784; MGC75238;
Gene ID 147808
mRNA Refseq NM_203374
Protein Refseq NP_976308
UniProt ID Q8NCA9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF784 Products

Required fields are marked with *

My Review for All ZNF784 Products

Required fields are marked with *

0
cart-icon
0
compare icon