Recombinant Human ZNHIT1, His-tagged
| Cat.No. : | ZNHIT1-31745TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-154 of Human ZNHIT1 with N terminal His tag; Predicted MWt 19kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-154 a.a. |
| Description : | ZNHIT1, Zinc finger HIT domain containing protein 1, appears to play a role in p53-mediated apoptosis induction. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 111 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNF QDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKL RFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPF CAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV |
| Full Length : | Full L. |
| Gene Name | ZNHIT1 zinc finger, HIT-type containing 1 [ Homo sapiens ] |
| Official Symbol | ZNHIT1 |
| Synonyms | ZNHIT1; zinc finger, HIT-type containing 1; zinc finger protein, subfamily 4A (HIT domain containing), member 1 , zinc finger, HIT domain containing 1 , ZNFN4A1; zinc finger HIT domain-containing protein 1; CG1I; H_DJ0747G18.14; putative cyclin G1 intera |
| Gene ID | 10467 |
| mRNA Refseq | NM_006349 |
| Protein Refseq | NP_006340 |
| Uniprot ID | O43257 |
| Chromosome Location | 7q22.1 |
| Function | metal ion binding; protein binding; |
| ◆ Recombinant Proteins | ||
| ZNHIT1-840H | Recombinant Human ZNHIT1 Protein, His-tagged | +Inquiry |
| ZNHIT1-2320Z | Recombinant Zebrafish ZNHIT1 | +Inquiry |
| ZNHIT1-5367R | Recombinant Rhesus monkey ZNHIT1 Protein, His-tagged | +Inquiry |
| ZNHIT1-5180R | Recombinant Rhesus Macaque ZNHIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZNHIT1-134H | Recombinant Human ZNHIT1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNHIT1-2095HCL | Recombinant Human ZNHIT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNHIT1 Products
Required fields are marked with *
My Review for All ZNHIT1 Products
Required fields are marked with *
