Recombinant Human ZNHIT1, His-tagged

Cat.No. : ZNHIT1-31745TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-154 of Human ZNHIT1 with N terminal His tag; Predicted MWt 19kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-154 a.a.
Description : ZNHIT1, Zinc finger HIT domain containing protein 1, appears to play a role in p53-mediated apoptosis induction.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 111 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNF QDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKL RFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPF CAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV
Full Length : Full L.
Gene Name ZNHIT1 zinc finger, HIT-type containing 1 [ Homo sapiens ]
Official Symbol ZNHIT1
Synonyms ZNHIT1; zinc finger, HIT-type containing 1; zinc finger protein, subfamily 4A (HIT domain containing), member 1 , zinc finger, HIT domain containing 1 , ZNFN4A1; zinc finger HIT domain-containing protein 1; CG1I; H_DJ0747G18.14; putative cyclin G1 intera
Gene ID 10467
mRNA Refseq NM_006349
Protein Refseq NP_006340
Uniprot ID O43257
Chromosome Location 7q22.1
Function metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNHIT1 Products

Required fields are marked with *

My Review for All ZNHIT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon