Recombinant Human ZNHIT3, His-tagged
Cat.No. : | ZNHIT3-31722TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2-155 of Human ZNHIT3 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-155 a.a. |
Description : | ZNHIT3 functions as a transcriptional coactivator and contains 1 HIT type zinc finger. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQ CNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLN SDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNL DQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES |
Gene Name | ZNHIT3 zinc finger, HIT-type containing 3 [ Homo sapiens ] |
Official Symbol | ZNHIT3 |
Synonyms | ZNHIT3; zinc finger, HIT-type containing 3; thyroid hormone receptor interactor 3 , TRIP3, zinc finger, HIT type 3; zinc finger HIT domain-containing protein 3; |
Gene ID | 9326 |
mRNA Refseq | NM_004773 |
Protein Refseq | NP_004764 |
MIM | 604500 |
Uniprot ID | Q15649 |
Chromosome Location | 17q21.1 |
Function | metal ion binding; thyroid hormone receptor binding; |
◆ Recombinant Proteins | ||
ZNHIT3-10607Z | Recombinant Zebrafish ZNHIT3 | +Inquiry |
ZNHIT3-19215M | Recombinant Mouse ZNHIT3 Protein | +Inquiry |
ZNHIT3-10487M | Recombinant Mouse ZNHIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNHIT3-2327H | Recombinant Human ZNHIT3, His-tagged | +Inquiry |
ZNHIT3-31722TH | Recombinant Human ZNHIT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNHIT3-9196HCL | Recombinant Human ZNHIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNHIT3 Products
Required fields are marked with *
My Review for All ZNHIT3 Products
Required fields are marked with *