Recombinant Human ZNHIT3, His-tagged
| Cat.No. : | ZNHIT3-31722TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 2-155 of Human ZNHIT3 with N terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-155 a.a. |
| Description : | ZNHIT3 functions as a transcriptional coactivator and contains 1 HIT type zinc finger. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQ CNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLN SDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNL DQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES |
| Gene Name | ZNHIT3 zinc finger, HIT-type containing 3 [ Homo sapiens ] |
| Official Symbol | ZNHIT3 |
| Synonyms | ZNHIT3; zinc finger, HIT-type containing 3; thyroid hormone receptor interactor 3 , TRIP3, zinc finger, HIT type 3; zinc finger HIT domain-containing protein 3; |
| Gene ID | 9326 |
| mRNA Refseq | NM_004773 |
| Protein Refseq | NP_004764 |
| MIM | 604500 |
| Uniprot ID | Q15649 |
| Chromosome Location | 17q21.1 |
| Function | metal ion binding; thyroid hormone receptor binding; |
| ◆ Recombinant Proteins | ||
| ZNHIT3-5368R | Recombinant Rhesus monkey ZNHIT3 Protein, His-tagged | +Inquiry |
| ZNHIT3-3878H | Recombinant Human ZNHIT3, GST-tagged | +Inquiry |
| ZNHIT3-5181R | Recombinant Rhesus Macaque ZNHIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZNHIT3-31722TH | Recombinant Human ZNHIT3, His-tagged | +Inquiry |
| ZNHIT3-19215M | Recombinant Mouse ZNHIT3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNHIT3-9196HCL | Recombinant Human ZNHIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNHIT3 Products
Required fields are marked with *
My Review for All ZNHIT3 Products
Required fields are marked with *
