Recombinant Human ZSCAN21, His-tagged
Cat.No. : | ZSCAN21-31654TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 178-473 of Human ZFP38 with N terminal His tag; MWt 44 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 178-473 a.a. |
Description : | Zinc finger and SCAN domain-containing protein 21 is a protein that in humans is encoded by the ZSCAN21 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 85 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEA EGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQ EAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLT KHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDR PYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSG KGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRL HTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWCH HCGKTFCSKSNLSKHQRVHTGEGEAP |
Gene Name | ZSCAN21 zinc finger and SCAN domain containing 21 [ Homo sapiens ] |
Official Symbol | ZSCAN21 |
Synonyms | ZSCAN21; zinc finger and SCAN domain containing 21; zinc finger protein 38 , zinc finger protein 38 (KOX 25) , ZNF38; zinc finger and SCAN domain-containing protein 21; DKFZp434L134; NY REN 21; Zipro1; |
Gene ID | 7589 |
mRNA Refseq | NM_145914 |
Protein Refseq | NP_666019 |
MIM | 601261 |
Uniprot ID | Q9Y5A6 |
Chromosome Location | 7q11.1 |
Function | DNA binding; metal ion binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
Zscan21-7129M | Recombinant Mouse Zscan21 Protein, Myc/DDK-tagged | +Inquiry |
ZSCAN21-10502M | Recombinant Mouse ZSCAN21 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZSCAN21-5284H | Recombinant Human ZSCAN21 protein, His-tagged | +Inquiry |
ZSCAN21-19239M | Recombinant Mouse ZSCAN21 Protein | +Inquiry |
ZSCAN21-119H | Recombinant Human ZSCAN21 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZSCAN21-9185HCL | Recombinant Human ZSCAN21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZSCAN21 Products
Required fields are marked with *
My Review for All ZSCAN21 Products
Required fields are marked with *