Recombinant Human ZSCAN21, His-tagged
| Cat.No. : | ZSCAN21-31654TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 178-473 of Human ZFP38 with N terminal His tag; MWt 44 kDa ; | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 178-473 a.a. | 
| Description : | Zinc finger and SCAN domain-containing protein 21 is a protein that in humans is encoded by the ZSCAN21 gene. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 85 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | LYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEA EGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQ EAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLT KHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDR PYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSG KGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRL HTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWCH HCGKTFCSKSNLSKHQRVHTGEGEAP | 
| Gene Name | ZSCAN21 zinc finger and SCAN domain containing 21 [ Homo sapiens ] | 
| Official Symbol | ZSCAN21 | 
| Synonyms | ZSCAN21; zinc finger and SCAN domain containing 21; zinc finger protein 38 , zinc finger protein 38 (KOX 25) , ZNF38; zinc finger and SCAN domain-containing protein 21; DKFZp434L134; NY REN 21; Zipro1; | 
| Gene ID | 7589 | 
| mRNA Refseq | NM_145914 | 
| Protein Refseq | NP_666019 | 
| MIM | 601261 | 
| Uniprot ID | Q9Y5A6 | 
| Chromosome Location | 7q11.1 | 
| Function | DNA binding; metal ion binding; protein binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; | 
| ◆ Recombinant Proteins | ||
| ZSCAN21-119H | Recombinant Human ZSCAN21 protein, His-tagged | +Inquiry | 
| ZSCAN21-10502M | Recombinant Mouse ZSCAN21 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ZSCAN21-19239M | Recombinant Mouse ZSCAN21 Protein | +Inquiry | 
| ZSCAN21-5284H | Recombinant Human ZSCAN21 protein, His-tagged | +Inquiry | 
| ZSCAN21-31654TH | Recombinant Human ZSCAN21, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ZSCAN21-9185HCL | Recombinant Human ZSCAN21 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ZSCAN21 Products
Required fields are marked with *
My Review for All ZSCAN21 Products
Required fields are marked with *
  
        
    
      
            