Recombinant Human ZSCAN31 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZSCAN31-3167H |
Product Overview : | ZNF323 MS Standard C13 and N15-labeled recombinant protein (NP_112161) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 24.2 kDa |
AA Sequence : | MEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZSCAN31 zinc finger and SCAN domain containing 31 [ Homo sapiens (human) ] |
Official Symbol | ZSCAN31 |
Synonyms | ZSCAN31; zinc finger and SCAN domain containing 31; ZNF323; ZNF310P; ZNF20-Lp; zinc finger and SCAN domain-containing protein 31; zinc finger protein 323 |
Gene ID | 64288 |
mRNA Refseq | NM_030899 |
Protein Refseq | NP_112161 |
MIM | 610794 |
UniProt ID | Q96LW9 |
◆ Recombinant Proteins | ||
ZSCAN31-833H | Recombinant Human ZSCAN31 Protein, MYC/DDK-tagged | +Inquiry |
ZSCAN31-3167H | Recombinant Human ZSCAN31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZSCAN31 Products
Required fields are marked with *
My Review for All ZSCAN31 Products
Required fields are marked with *