Recombinant Human ZSCAN31 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZSCAN31-3167H
Product Overview : ZNF323 MS Standard C13 and N15-labeled recombinant protein (NP_112161) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Alternative splicing results in multiple transcript variants.
Molecular Mass : 24.2 kDa
AA Sequence : MEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZSCAN31 zinc finger and SCAN domain containing 31 [ Homo sapiens (human) ]
Official Symbol ZSCAN31
Synonyms ZSCAN31; zinc finger and SCAN domain containing 31; ZNF323; ZNF310P; ZNF20-Lp; zinc finger and SCAN domain-containing protein 31; zinc finger protein 323
Gene ID 64288
mRNA Refseq NM_030899
Protein Refseq NP_112161
MIM 610794
UniProt ID Q96LW9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZSCAN31 Products

Required fields are marked with *

My Review for All ZSCAN31 Products

Required fields are marked with *

0
cart-icon