Recombinant Human ZSCAN31 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZSCAN31-3167H
• Product Overview: ZNF323 MS Standard C13 and N15-labeled recombinant protein (NP_112161) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 24.2 kDa
• AA Sequence: MEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZSCAN31 zinc finger and SCAN domain containing 31 [ Homo sapiens (human) ]
• Official Symbol: ZSCAN31
• Synonyms: ZSCAN31; zinc finger and SCAN domain containing 31; ZNF323; ZNF310P; ZNF20-Lp; zinc finger and SCAN domain-containing protein 31; zinc finger protein 323
• Gene ID: 64288
• mRNA Refseq: NM_030899
• Protein Refseq: NP_112161
• MIM: 610794
• UniProt ID: Q96LW9