Recombinant Human ZWILCH Protein, GST-tagged
Cat.No. : | ZWILCH-4211H |
Product Overview : | Human FLJ10036 full-length ORF ( AAH36900, 1 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ZWILCH (Zwilch Kinetochore Protein) is a Protein Coding gene. Among its related pathways are Mitotic Metaphase and Anaphase and Signaling by GPCR. |
Molecular Mass : | 78.21 kDa |
AA Sequence : | MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ZWILCH Zwilch, kinetochore associated, homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | ZWILCH |
Synonyms | ZWILCH; Zwilch, kinetochore associated, homolog (Drosophila); protein zwilch homolog; FLJ10036; KNTC1AP; homolog of Drosophila Zwilch; hZwilch; FLJ16343; MGC111034; |
Gene ID | 55055 |
mRNA Refseq | NM_017975 |
Protein Refseq | NP_060445 |
MIM | 609984 |
UniProt ID | Q9H900 |
◆ Recombinant Proteins | ||
ZWILCH-3886H | Recombinant Human ZWILCH, His-tagged | +Inquiry |
ZWILCH-4211H | Recombinant Human ZWILCH Protein, GST-tagged | +Inquiry |
ZWILCH-216H | Recombinant Human ZWILCH, His-tagged | +Inquiry |
ZWILCH-4831HF | Recombinant Full Length Human ZWILCH Protein, GST-tagged | +Inquiry |
ZWILCH-7873Z | Recombinant Zebrafish ZWILCH | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZWILCH-2103HCL | Recombinant Human ZWILCH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZWILCH Products
Required fields are marked with *
My Review for All ZWILCH Products
Required fields are marked with *