Recombinant Hypocrea Jecorina HFB1 Protein (23-97 aa), His-SUMO-tagged

Cat.No. : HFB1-2128H
Product Overview : Recombinant Hypocrea Jecorina (Trichoderma reesei) HFB1 Protein (23-97 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Hypocrea Jecorina
Source : E.coli
Tag : His&SUMO
Protein Length : 23-97 aa
Description : Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 23.5 kDa
AA Sequence : SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms hfb1; Hydrophobin I Short name:HFBI;
UniProt ID P52754

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HFB1 Products

Required fields are marked with *

My Review for All HFB1 Products

Required fields are marked with *

0
cart-icon